KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_2376Help
Entry
LP6_2376          CDS       T02689                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase (copper-zinc)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Brite
Enzymes [BR:lpm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LP6_2376 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGN15267
LinkDB All DBs
Position
2710454..2710942
Genome map
AA seq 162 aa AA seqDB search
MNKSGIILIGTILFSSMAIADDLTAPIYTTGPKPVAIGKVTFTQTPYGVLITPDLTNLPE
GPHGFHLHKTADCGNHGMHAEGHYDPQNTNSHQGPYGNGHLGDLPVLYVTSNGKAMIPTL
APRLKLSDMHNLAVMIHANGDTYSDNPPQGGGGDRIACGVIK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaggaataatattaattggtactattttattctcaagcatggctattgcc
gatgatcttacagcaccaatttacacaactggtcccaaaccagttgcaataggcaaggta
accttcacacaaaccccttatggtgttttgattacaccagacttaactaaccttcctgaa
ggtccgcatggtttccatttacataaaactgcagattgtggtaaccacggaatgcatgca
gaaggacattatgatcctcaaaataccaatagccaccaaggcccttatggtaacgggcat
ttgggagatttacctgttttatatgtcacaagtaatgggaaagcaatgatacctacttta
gcccctcgtttgaaattaagtgatatgcacaatttagctgtcatgatccatgccaatgga
gacacttacagtgacaatcctccacaaggtggcgggggggaccgtatagcgtgcggcgtc
attaaatag

DBGET integrated database retrieval system