KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_2298Help
Entry
LPO_2298          CDS       T02175                                 

Gene name
fabD
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2425756..2427501
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPNKKSCTFLNKELEETMTYEQLDQHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPKFLKTPAIALENIELNRGSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHISKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
SETMEHFYQAFKDYGFRKEAFYPCYGLAEATLLVTGGTPGNPYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETKH
AFAGKIKDDGRSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEIHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggttgacgttgtcaggttacgtgcttta
cacagccctaacaagaaaagctgtacttttctgaacaaagagttggaagagacgatgact
tatgagcaactggatcaacacgccaaagcaattgcggcaactttgcaagcagaaggagca
aaacctggggatagggtcttgttattgtttgcacctggattaccccttatccaggcattt
ttgggctgcctttatgcaggctgcattgctgtacccatttacccgccagcccaagaaaaa
ttattggacaaggcacaacgcatagttaccaactcaaaaccggtaatagtactgatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatcccaaattcctgaaa
actcctgctattgcgcttgaaaatattgagttaaacagaggtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttttacaatacacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttactggacaatctgaataaaatttttacttct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattctgacacccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattagtaaatacagagccact
attagtggcagcccgaatttcgcttacgattattgtgtcaaacgaatcagggaagaaaaa
aaagaagggctggatttaagttcatgggtaaccgcattcaacggcgctgagccagtgcga
tcagaaaccatggaacatttttatcaggcatttaaagactatggatttcgtaaagaagcc
ttctacccatgctatggcctggccgaggctactttgttagtgacgggaggaacaccagga
aatccatacaaaacattaactctggccaaagaacaatttcaggatcatcgcgtacatttt
gctgacgataacagcccgggcagttacaagttagtcagcagtggtaatcccattcaagca
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgccaaaggatattggaatcaacccgaagaaacaaagcat
gcgttcgcaggaaaaattaaagacgatgggcgtagcgcaatctatttaagaaccggggac
ttgggctttctccatgaaaatgagttatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattatcctcaggacatagagttcagcctgatgcattctcctctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaggagcatgaatataaactg
acagtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgaacttgtttacgaaaaccaccaattggagatacatactatcgtcctc
attcctcttaaggcaatgccacatactaccagtggaaaaattcgcaggaatttttgccga
aaacatcttttggataaaactctgccaatagtggctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system