KEGG   Legionella pneumophila Paris: lpp1643Help
Entry
lpp1643           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00500  Starch and sucrose metabolism
lpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpp1643
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     lpp1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF4795 UCH Com_YlbF
Motif
Other DBs
NCBI-ProteinID: CAH12795
Pasteur: lpp1643
LinkDB All DBs
Position
1842391..1844508
Genome map
AA seq 705 aa AA seqDB search
MGYHFLAEGNGIIACYDMYPTQFHSIKDMINYLPVLKQMGFNALWINPMQMPGDISGFFK
TDKNNGVKTGNEVTRSLYAMSHPLLFNPQFSLDSPEDPMETTQRLNSEALQLFTQNARNL
GIVPMFDLVLNHVAIDSPLCQDKPHWFKGVHEDFKDVRGFNYDDESIRKEIITEFWQPYI
KRYMIEYGFDGVRVDAVGYVHPAVRSEVYAYIHSLAAEYGKPNPVILDEALFSKRPLADE
VNYLKLPGIGPTHITTEAYNVEFDLASADLPYEITLEEQLKASVVFQQKDGTWRENTKGG
CINFCGNHDYRSLAMTILFQMAKKRLKSDAFYNDLISSYQDLYFKFNAEQEKPHELKEPL
KTTLLYSYVDQIKKELEDNKDETAQEFKTLVLEKLALSALTASGGWFLLSGDETCDITAK
TVFQRKGAVDKSYYPQREHRIFSEKPVIAHKILEKMAEENFFIENSENKWMQELYRSLSS
FPEMQKRLLVSHIDNIKHQINAGIDHVQEKFSRLLASESLNIGFTSQDFLENPRTHENGW
LGLQDNFLFIKQLNRLLKTLPAPLPGFSSELVRLPEKPHLIIIVRKNGNELNAPIDVVVV
NLEQEKRQTLTKEDFQLIAKNYCNQYFSKNRPSVCDSLREKLYSHVLKSAVNNRVHTDTS
IKLNGIHLFEFKETSLNTFFTIEKEKNYSHGNEDHTALTGNTILH
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcattttttagcagaaggaaatgggattattgcatgttatgacatgtaccca
actcagtttcattctattaaggacatgattaattatttgcctgtcttaaagcagatgggg
tttaatgccttatggattaatcccatgcaaatgcccggtgacattagcggcttttttaaa
acggataaaaataatggtgtaaaaacaggaaatgaggtcactagaagcttatatgccatg
agtcacccgttattatttaatcctcaattcagtttggactcccctgaagaccccatggag
acaacccaacgattaaactcagaagctttacagttattcactcaaaatgcaaggaacctc
ggaatagttccaatgtttgatctggttttaaatcatgtcgccattgattctcccttgtgt
caggataagcctcattggttcaaaggagttcatgaagacttcaaagatgttcgcggcttc
aattatgatgatgaaagcataagaaaagaaataataaccgaattttggcaaccttatatc
aaacgttacatgatcgagtacggttttgatggtgttcgagtcgatgctgtaggttatgta
catcctgcagtaagaagtgaagtatatgcctatattcactctcttgctgctgaatatggt
aaaccaaatccggttatccttgatgaagctttatttagtaaacgaccacttgcggatgaa
gtaaattatttgaaattacccggcattggcccaactcacatcactacagaagcttataat
gttgaatttgatcttgccagcgctgatctgccttatgaaataacattggaagagcagtta
aaggcgagtgtagtcttccaacaaaaagatggaacatggcgtgaaaacacgaaggggggc
tgcattaatttttgtgggaatcatgactatcgttcattggcgatgactattttatttcaa
atggccaaaaaaagactgaaatctgacgctttttataatgacttaatatcttcctatcaa
gacttgtactttaagtttaacgccgagcaagaaaaaccacatgaactcaaggagcctttg
aaaacaaccttactttactcttatgttgatcaaatcaaaaaggagttggaagataataaa
gatgaaacagcacaagaatttaaaactctggtattagaaaaactggctttatctgctctt
acagccagtggcggatggtttttattatctggtgatgaaacatgcgatatcactgcaaaa
acagtatttcagagaaaaggtgctgttgataaatcttattacccacaacgtgaacatcgt
atttttagtgaaaaaccagttattgctcacaaaattttagaaaaaatggcagaagagaat
ttcttcatagaaaactcggaaaataagtggatgcaggaactttaccgaagtttatcaagt
tttcctgaaatgcaaaaacgtcttttagtatctcatattgataatattaaacaccaaata
aatgccggcatagatcatgtacaagaaaaattttccaggctacttgccagtgaaagttta
aatataggtttcacatctcaagattttttagagaatccaagaacccacgaaaatggatgg
cttggattacaggataattttctatttatcaaacaattaaatagattattaaaaacacta
cctgcaccactacccggattctccagtgagttggttcgactccctgaaaaaccgcatctc
attattatcgtaagaaaaaatggtaatgaattaaatgctccaattgatgttgttgttgtt
aaccttgaacaggaaaaacgacaaacattaactaaagaagattttcaattaattgccaaa
aactattgtaatcaatatttttctaaaaatagaccgagtgtttgcgatagtttacgcgaa
aaattatattcccatgttttaaaatctgctgtaaataatcgagtccatacagacaccagt
attaaactgaatggaatccatttatttgagtttaaagaaacttcgttaaacacttttttt
acaattgaaaaagaaaaaaactattctcatggaaatgaagaccatactgctttgactgga
aatacaatcttgcattag

DBGET integrated database retrieval system