KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0480Help
Entry
LBP_cg0480        CDS       T02670                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00010  Glycolysis / Gluconeogenesis
lpr00260  Glycine, serine and threonine metabolism
lpr00680  Methane metabolism
lpr01100  Metabolic pathways
lpr01110  Biosynthesis of secondary metabolites
lpr01120  Microbial metabolism in diverse environments
lpr01130  Biosynthesis of antibiotics
lpr01200  Carbon metabolism
lpr01230  Biosynthesis of amino acids
Module
lpr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBP_cg0480
  Energy metabolism
   00680 Methane metabolism
    LBP_cg0480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBP_cg0480
Enzymes [BR:lpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBP_cg0480
Membrane trafficking [BR:lpr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBP_cg0480
Exosome [BR:lpr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBP_cg0480
  Exosomal proteins of melanoma cells
   LBP_cg0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGL63226
LinkDB All DBs
Position
510692..511369
Genome map
AA seq 225 aa AA seqDB search
MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRATGLQFGAVHTSVLKR
AIVTANIMLSEIDQLWLPEYKTWRLNERHYGALRGQNKDVTRQEYGKAQVQQWRRSFYTV
PPLLTPAELDHDRRYTKYGAAVEPRGESLKMAYDRIMPYWIDEIAPRLLDGQNQLVVAHG
STLRAMIKYLEHISDTGIDGVEVANGVPICYHLDQQLHVIGKEEY
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactagtattggttcgccatggtgagagtacggccaatcgggataatacgtat
accggttggagtgacgtcccgctaacagcagtgggtattgcacaggctcatcaagctggc
aagcgattacgagctacgggactgcagtttggcgctgtgcatacctcagtcctaaaacgg
gctatcgttaccgcgaatattatgttaagtgaaattgatcagttatggctgcctgagtat
aagacgtggcggttaaatgaacgacattacggtgccttacgtggtcaaaataaggatgtg
actcgtcaagagtacggtaaggcgcaagttcaacagtggcggcggagcttttatacggtg
ccgccgttgttgacaccagctgaactagaccatgatcgacgttacaccaagtacggtgcc
gccgtcgaaccgcggggagaaagcttgaagatggcttacgaccgcatcatgccttattgg
atcgatgagattgcaccgcggctgttagacggccaaaaccaactcgtggtggcgcatggt
agtacgttgcgtgcgatgatcaaatatttagagcatattagtgatactgggattgatggt
gtcgaagttgctaacggggtgccaatttgttatcaccttgatcagcaactgcacgttatc
ggtaaagaagagtattaa

DBGET integrated database retrieval system