KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_00866Help
Entry
LPE509_00866      CDS       T02511                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(874813..876558)
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPNKKSCTFLNKELEETMTYEQLDQHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPKFLKIPAIALESIELNRSSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYKATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
EETMEHFYQAFKEFGFRKEAFYPCYGLAEATLLVTGGTPGSSYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQEVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETRH
AFAGKIKDDERSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggttgacgtcgtcaggttacgtgcttta
cacagccctaacaagaaaagctgtacttttctgaacaaagagttggaagagacgatgact
tatgagcaactggatcaacacgccaaagcaattgcggcaactttgcaagcagaaggagca
aaacctggggatagggtcttgttattgtttgcacctggattaccccttatccaggcattt
ttgggctgcctttatgcaggctgcattgctgtacccatttacccaccagcccaagaaaaa
ttattggacaaggcacaacgcatagttaccaactcaaaaccggtcatagtactgatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatcccaaattcctgaaa
attcctgctattgcgcttgagagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttctgcaatacacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttactggataatctgaataaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattctgacccccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattaccaaatacaaagcaact
atcagtggaagccctaacttcgcttacgattattgtgtcaaacgaatcagggaagaaaaa
aaagaagggctggatttaagttcatgggtgactgctttcaacggtgctgagccagtacga
gaagaaaccatggaacatttttatcaggcatttaaagagtttggatttcgtaaagaagcc
ttctatccatgctatggcctggctgaggccactttgttagtgacgggaggaacaccagga
agttcatacaaaacattaactctggccaaagaacaatttcaagatcatcgcgtgcatttt
gcagacgataacagtccaggcagttacaagttagtcagcagtggtaatcccattcaagaa
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgccaaaggatattggaatcaacccgaagaaacaaggcat
gcgttcgcaggaaaaattaaagacgatgagcgtagcgcaatctatttaagaaccggggac
ttgggctttctccatgaaaatgagttatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattatcctcaggacatagagttcagcctgatgcattctccgctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaggagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacatactaccagcggaaaaattcgcaggaatttttgtcga
aaacatcttttggataaaactctgccaatagtggctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system