KEGG   Lactobacillus salivarius JCM1046: LSJ_0636Help
Entry
LSJ_0636          CDS       T03340                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lsj  Lactobacillus salivarius JCM1046
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LSJ_0636 (tdk)
Enzymes [BR:lsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LSJ_0636 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
634806..635411
Genome map
AA seq 201 aa AA seqDB search
MAQLFFRYGAMNSGKTIEILKVAHNYEEQGKNVIIMTSGLDNRDGYGYVSSRIGLKRKAI
PVVSETNIKDLVEQSSLEPACILVDEAQFLEKHHVLELTQIVDELNIPVMTFGLKNDFMN
ELFEGSKYLLLYADKIEEMKTICWFCNKKAIMNLRMHDSKPVYSGEQIMIGGNESYYPVC
RKHYFNPPINNLEKDEGEING
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacttttttttcgctatggagcgatgaatagtggtaagacaatcgaaatcctt
aaagttgcacataattatgaagaacaagggaaaaatgttattatcatgacaagtggtttg
gataatcgcgatggttatggttatgtttctagtcgtataggtttgaaaagaaaagctatt
ccagttgttagtgaaactaatattaaagatctagtagaacaatcttctttagagcctgcc
tgtattttagttgatgaggcacaatttttagaaaaacatcatgtattggaattaactcag
attgtagatgaactgaatattcctgtaatgacttttgggttaaaaaatgattttatgaat
gagttgtttgaaggatctaaatatcttttattatatgctgacaaaatagaagaaatgaag
acaatttgttggttttgtaataaaaaggctattatgaatttaagaatgcatgattctaaa
ccggtatatagtggtgaacagataatgattggtggtaatgaatcttattatccagtatgt
agaaaacattattttaatccacctattaataatttagaaaaagatgaaggagaaataaat
ggataa

DBGET integrated database retrieval system