KEGG   Lactuca sativa (garden lettuce): 111889048Help
Entry
111889048         CDS       T05352                                 

Definition
(RefSeq) beta-galactosidase 17 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00052  Galactose metabolism
lsv00511  Other glycan degradation
lsv00531  Glycosaminoglycan degradation
lsv00600  Sphingolipid metabolism
lsv00604  Glycosphingolipid biosynthesis - ganglio series
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111889048
  Lipid metabolism
   00600 Sphingolipid metabolism
    111889048
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    111889048
   00604 Glycosphingolipid biosynthesis - ganglio series
    111889048
   00511 Other glycan degradation
    111889048
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     111889048
Exosome [BR:lsv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111889048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Glyco_transf_41
Motif
Other DBs
NCBI-GeneID: 111889048
NCBI-ProteinID: XP_023740945
LinkDB All DBs
Position
Unknown
AA seq 694 aa AA seqDB search
MAKGRSLKSTKIIVLLLCLVAFSTVFAPLPSPLSNSLKPHNHHHHHHHHHQQVVNARKFE
IADDMFWKDGEPFRIIGGDLHYFRTLPEYWEDRLTRAKALGLNAIQTYVPWNLHEPKEGQ
LDFNAIADIVSFLELCQKLDLLVMLRAGPYICAEWDLGGFPAWLLTKKPPIRLRSSDPTY
LALVDKWWGVLLPKIAPLLYHKGGPIIMVQIENEFGSYGVDKDYLHHLVNLARSHLGDDL
ILYTTDGGTRDTLIKGTINGDAVFSAVDFSTGEDPWPIFNLQKEFNTPGKSPPLSAEFYT
GWLTHWGENIAKTDATSTASALEKILSRNGSAVLYMAHGGTNFGFYNGANGAQESEYLAD
LTSYDYDAPISESGDVDGAKFKALRRVIAKYSAASLPPVPKNNEKTGYGRIQLEKSSSLF
DILDTNVHIKAIEAENPISMEAAGQMFGFLLYTSEYIANGKGSTLSIPKVHDRAQVYVTC
LSKNKKERPQYVATINRWSNKPVNLPNTGCASTSKLLILVENMGRLNYGQLLFDSKGILS
PVYLDGKPLLKWKMLPIPLSNLNEPKKINPVFDKPYSTFIRASTRKTLKSSLRVDLNEPD
FYTGDFVVDKVTDTYMSFNGWGKGVAFVNDFNIGRFWPSFGPQCNLYVPAPVLRRGKNVL
VILELESPERELVVNSVNQSDFTCGSKHTRVRQL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagggcgaagcttgaagtcgacgaagattatcgttcttctcctatgtctcgtt
gctttctctactgttttcgctcctctaccttcccctctctcgaattcgctcaaaccccac
aatcatcatcatcatcatcatcatcatcatcaacaggttgttaatgctcgaaagtttgaa
attgctgatgatatgttctggaaagatggagagccttttagaatcatcggcggggacttg
cattatttccgtactctacctgagtattgggaagataggctaacaagagcaaaggctttg
ggcttgaatgcaattcaaacttatgttccatggaatctgcatgaaccaaaagagggtcaa
ctagatttcaatgctattgcagatatagtttcttttcttgagctgtgtcagaagttagat
ttgctggtcatgctaagggctggaccttacatatgtgcagaatgggatcttggtggtttc
cctgcttggttacttactaaaaaaccacccatcagactgagatcatcagatccaacatac
ctcgcattggttgataagtggtggggggtattacttcctaaaattgctcctcttctttac
cacaaaggaggacctataattatggttcagattgagaatgaatttggttcctatggagtt
gacaaagactatctgcatcatctggtcaacttagcaagatcacatcttggggatgaccta
atattatatactacagatggaggcactagagatactctcattaaaggaacaataaatgga
gatgctgtcttttcagctgttgatttttcaactggagaggatccttggcctatatttaat
ttgcaaaaggagtttaatacaccaggaaaatcaccacctctttctgctgaattttacacg
ggttggcttacacattggggagagaatattgctaaaactgatgcaacttctacagcatct
gcccttgaaaaaattttgtccaggaatggctctgctgtgctttatatggctcatggtgga
accaactttggattttataatggtgcaaatggtgctcaggaatccgagtaccttgctgat
cttacatcctatgattatgatgctcctattagtgagtctggtgatgtggatggggcaaaa
tttaaagcattgcggagagttatagctaagtatagtgcagcttctctccctccagttccc
aagaataatgagaagacaggatatggtcgaattcagttagaaaaatcatcatctttattt
gatatactggacactaatgtgcacattaaagctattgaagctgagaatccaatttcaatg
gaggctgcaggccagatgtttggattcttattatatacctctgaatacatagcaaatgga
aaggggagtactttgtccataccaaaggtgcatgatagagcccaagtgtatgttacatgt
ctttctaaaaacaagaaagagagaccacaatatgttgcaacaatcaatcgatggtcaaat
aagcctgttaatcttcccaatactgggtgtgcttccactagtaaattgttaattctggtt
gaaaacatgggtcgtttgaattacggacaactcttgtttgatagcaagggcatactatcc
cctgtttacttagatgggaaacctctgctcaagtggaaaatgctcccaattcctcttagc
aatctaaacgaacccaaaaaaataaatcccgtttttgacaagccatattccactttcatt
agagcttctactcgcaaaaccctaaaaagcagcttgcgagtggatttaaatgaaccggat
ttttatactggtgattttgttgttgacaaagtaacagacacatatatgtcatttaatggg
tggggtaaaggggtagcatttgtcaatgacttcaatatcggaagattctggccgtctttc
gggccccagtgtaacctctatgttcctgctccagttcttcgacgtgggaagaacgtcttg
gttatactcgagctcgaaagtccagagcgtgagctcgtggtcaattcagtgaatcagtca
gacttcacttgcggttcgaaacatacgagggtacgtcagctgtaa

DBGET integrated database retrieval system