KEGG   Lachancea thermotolerans: KLTH0D09592gHelp
Entry
KLTH0D09592g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D09592p
  KO
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLTH0D09592g
Chromosome [BR:lth03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KLTH0D09592g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
D:complement(792708..794825)
Genome map
AA seq 705 aa AA seqDB search
MSKEVDPLLKFEHQFQSFVRNNPNVASAAHSASQIPESAKAVVVLSPLSLQHQFPRYWVS
KSYKKTIVERPERLLACSMGIGAAITMYPALFTLKSSHKRKTSLLSDHVLKVHGSDWPQE
LLKLCKNSQKALDQCQVEVPESWNVGDIYLSRQTISALEGSIGALETGVDSIFHGPSVEQ
TSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTYGVTHAVVLDFDLHHGDGTQ
DICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKENVRNA
ATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMRALGKPFK
GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLSVLEGGYSD
GAISSGVFAHLIGLQNQNWINEWGSAQVVKEIVRGCKPQWKPYKTKRARDVIRIWAEEVI
KLGRAMIPEFEQVLFEPELVEPKAETSKRITRSRRAPAAASIAVVKTPPTLPRSETPTPN
DKRYIQKLETADVETVPFVEQDLPSDNEDEDDEDYVYDEELNKTFNRTVEDITIDDISRH
LETLEIEPEALDDAPPRTASSSGTRASSRNADSEAAAAAAAGAPQERRPLSSSSGGYKIP
SGSTTRHLRNTRASRLMNFDDSDISMISHVSPTKGRSTRSGQTKW
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaggtcgacccgctgctcaaattcgagcaccagttccagtcgtttgtgagg
aacaaccccaacgtggcgtctgctgcgcatagtgcgtcgcagattccagaatctgcaaaa
gcggtagtggtgctatcccctctgtcgcttcagcaccagtttccgcggtactgggtgtcc
aagtcctataagaaaacgattgtcgagcggcccgagaggctgttagcgtgctcaatgggt
ataggcgcggccatcactatgtacccggcgctgttcacgctaaaatcgtcgcacaagcga
aagacttctctgctctcggatcatgtgctgaaggtgcacggcagtgactggccacaagag
cttttgaagctctgcaaaaactcgcagaaggcactggaccagtgccaggtcgaggttccg
gagtcttggaacgtcggcgacatctacttgtccaggcagaccatcagcgccttggagggc
tcaattggcgcgcttgagaccggcgtggactccatattccacgggccttcagtcgagcag
accagcaaccgtgcattcgtggcgctgagaccaccaggccatcactctcacgcctccaca
ccctcggggttctgcttgctgaacaacgcgcacatcgccatcgaatacgccgcagacaca
tacggcgtaacgcacgcggtcgtgctggatttcgatttgcatcatggcgacgggacccag
gacatttgttggaagagagcaggcttcaaacccgatggatgcgacgacggcggctccgag
tataacgagttcggcaagaagtttgcggagttccctaaagtcgggtatttctcgctgcac
gacatcaactcgttcccaaccgagctgggctacgccacgaaagaaaacgtcagaaatgcg
gccacctgcatcatggacgcacacgatgtgaacatctggaatgttcacctgcagtcgtat
gactctgacgaagccttcaccaaactataccaaacgaagtaccggaccctgtttgcgaaa
gcagacgagtactttagaactgccaaacagaacatgagggcactgggcaagcccttcaag
ggcctggtcgtgatcagcgccgggttcgatgcctcagagtacgagcagccatcaatgcag
agacacgctgtgaacgtgcccacgttcttttacaatctgttcacgaaggacgctctgaag
ctcgcccaaatgcattcgcatggcaaactactgtcggtgctcgaggggggctactccgac
ggggcgatctcctctggcgtattcgctcatttgatcggcttacaaaaccagaactggatc
aatgagtggggctctgcgcaggtggtgaaggagattgtgcgcgggtgcaaaccgcaatgg
aagccttacaagaccaaacgcgcgagagacgtgatccgaatctgggccgaagaggtgatc
aaactggggagggctatgatccccgagtttgagcaggtcttgtttgagcccgagctcgtg
gagcccaaggccgagacctccaagcgcatcacaagatctagaagggctcctgctgccgcg
tccatagccgttgtcaaaacgccgcccacgctgccccgcagcgaaacgccgacgcccaac
gacaagcgctacatacagaagctggagaccgcggacgtcgaaaccgtaccgtttgtggag
caggacctgcccagcgacaacgaagacgaggacgacgaggattatgtatacgacgaggag
ctcaataagacattcaaccgcacggtggaggacattactattgacgatatttccaggcac
ctggagaccctggagatagaacccgaggcgctcgacgacgcgcctccgcgcactgcgtct
agttcagggaccagggccagctcccgcaatgccgactccgaggccgcggcagcagcggcg
gccggcgcgccgcaggagcgccgtccgctctcgtcatccagcggaggctacaagatacct
tcagggtccaccacacgccatctgcgcaacacgcgggcatcgcgcctgatgaacttcgac
gacagcgatatctcgatgatctcgcatgtgtcaccgacaaagggccgctctacacgcagc
ggccagaccaagtggtag

DBGET integrated database retrieval system