KEGG   Lipotes vexillifer (Yangtze River dolphin): 103072982Help
Entry
103072982         CDS       T03090                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04146  Peroxisome
lve04213  Longevity regulating pathway - multiple species
lve05014  Amyotrophic lateral sclerosis (ALS)
lve05016  Huntington's disease
lve05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:lve00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103072982 (SOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    103072982 (SOD1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    103072982 (SOD1)
   05016 Huntington's disease
    103072982 (SOD1)
   05020 Prion diseases
    103072982 (SOD1)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103072982 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103072982
NCBI-ProteinID: XP_007447482
LinkDB All DBs
Position
Un
AA seq 153 aa AA seqDB search
MATKAVCVLKGDGPVQGTIHFEQKEDGTVVVSGSITGLTEGDHGFHVHQFGDNTQGCTSA
GPHFNPLSRKHGGPEDEERHVGDLGNVKADQNGVAEVCIEDSIISLSGDRSIIGRTMVVH
EKPDDLGRGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggccgtgtgcgtgctgaagggcgacggcccggtgcagggtaccatccac
ttcgaacaaaaggaagatgggacggtcgtggtatcgggatccattacaggattgactgaa
ggcgatcatggattccatgtccatcaatttggagataatacacaaggctgtaccagtgca
ggtcctcactttaaccctctatccagaaaacacggtgggccagaggatgaagagaggcat
gttggagacctgggcaatgtgaaggctgaccaaaatggtgtggccgaagtgtgtattgaa
gattctataatctctctctctggagaccgttccatcattggccgcacaatggtggtccat
gaaaaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagacaggaaatgct
ggaagtcgtttggcctgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system