KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082567Help
Entry
103082567         CDS       T03090                                 

Definition
(RefSeq) glutathione S-transferase domain-containing protein DDB_G0274223-like
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 103082567
NCBI-ProteinID: XP_007451681
LinkDB All DBs
Position
Un
AA seq 205 aa AA seqDB search
MIDLYYWATPNGHKITIALEEMELDYQIFPINIMENDQFQPDFLKISPNNKIPAIVDQDG
PRGEPISVFESGAILQYLGRKTGLFYSQDEQERVEVEQWLMWQMGGLGPMLGQNHHFSRF
APEKIPYAIERYLNETKRLYSVLNKQLIGQKFVAGEYSIADMAILPWILRYEWQGIQLED
YPYVKEYVERLTARPAIQRALSIQL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctgtattattgggctacgccaaatggccataagattacgattgcccttgaa
gaaatggagctggattatcagatttttccgatcaatattatggaaaatgaccagtttcag
ccagactttttgaaaatttctcctaacaataaaattccggcaattgttgatcaggatggg
ccacgtggtgaacctatttctgtttttgaatcaggcgcaattttgcaatatttaggtcgc
aaaacaggccttttctattcacaggatgagcaggaacgggtagaggttgaacaatggtta
atgtggcaaatgggcggacttggcccgatgcttgggcaaaatcatcattttagccgtttt
gcgccggaaaaaattccatatgccatagagcgctatctaaatgaaacaaagcgcttgtat
agcgtattaaacaaacagctcatcggccaaaaatttgtagctggggagtactctattgca
gatatggcaattttaccctggattttacgctatgaatggcagggaattcagttagaagac
tatccatatgtgaaagaatatgtagagcgcctaacagcacgtcctgccatacagcgggct
ttatctattcagctttaa

DBGET integrated database retrieval system