KEGG   Lipotes vexillifer (Yangtze River dolphin): 103088613Help
Entry
103088613         CDS       T03090                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00590  Arachidonic acid metabolism
lve01100  Metabolic pathways
lve04064  NF-kappa B signaling pathway
lve04370  VEGF signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04668  TNF signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04726  Serotonergic synapse
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve05140  Leishmaniasis
lve05165  Human papillomavirus infection
lve05167  Kaposi's sarcoma-associated herpesvirus infection
lve05200  Pathways in cancer
lve05204  Chemical carcinogenesis
lve05206  MicroRNAs in cancer
lve05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103088613 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    103088613 (PTGS2)
   04064 NF-kappa B signaling pathway
    103088613 (PTGS2)
   04668 TNF signaling pathway
    103088613 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    103088613 (PTGS2)
   04657 IL-17 signaling pathway
    103088613 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103088613 (PTGS2)
   04913 Ovarian Steroidogenesis
    103088613 (PTGS2)
   04921 Oxytocin signaling pathway
    103088613 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    103088613 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    103088613 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103088613 (PTGS2)
   05206 MicroRNAs in cancer
    103088613 (PTGS2)
   05204 Chemical carcinogenesis
    103088613 (PTGS2)
   05222 Small cell lung cancer
    103088613 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    103088613 (PTGS2)
   05165 Human papillomavirus infection
    103088613 (PTGS2)
   05140 Leishmaniasis
    103088613 (PTGS2)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103088613 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103088613
NCBI-ProteinID: XP_007451212
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCGAANPCCSSPCQNRGVCMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNMIMRYVLISRSHLIESPPTYNVHY
GYKSWEAFSNLSYYTRVLPPVPDDCPTPMGVKGRKELPDSKEVVEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTTGQSHGVDLNHVYGESLERQHKLRLFKDGKMKY
QIIGGEMYPPTVKDTQVKMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKHEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDGQDYKYQQFVYNNSLLLEHGLTQFVESFTRQIAGRV
AGGRNLPVAVEKVSKASIDHSREMKYQSFNEYRKRFLLKPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctagcccgcgcgctgctgctctgcgccgccctggcgctctgtggtgcagcaaatcct
tgctgttccagtccatgccagaatcgaggtgtatgtatgagcataggatttgaccagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaacacagtgcactacatacttacgcac
ttcaagggagtctggaacattgtcaataacattcccttcctgcagaatatgattatgaga
tatgtgttgatatcgagatcacatctgattgagagcccgccaacttataatgtgcactac
ggctataaaagctgggaagccttttctaacctgtcctattacaccagagttcttcctcct
gtgcctgatgactgcccaacacccatgggtgtcaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaagtacttctaagaagaaagttcatccctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccacgggacagagccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattggtggtgaaatgtatcctcccacagtcaaagatactcaggtcaagatgatc
tacccccctcatgttcctgaacacctgcggtttgctgtggggcaggaagtctttggtctg
gtgcctggtctgatgatgtatgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacatgagcatccagaatgggacgatgaacagttgttccagacgagtaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacagcacctgagtggc
tatcacttcaaactgaagtttgacccagagctgctttttaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
tttcagattgatggccaggactacaagtatcagcaatttgtctataacaactccctctta
ttggaacacggcctcactcagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatcttccagttgcagtagagaaagtatcaaaggcttcaattgaccac
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgctttctgctgaagcct
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacattgatgccatggagctgtatcctgctcttctggtagaaaagcctcgacca
gacgccatctttggggagaccatggtagaagctggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataatgtgaaaggc
tgtccttttacctcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcccactctggactagacgatatcaaccctacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system