KEGG   Lacinutrix venerupis: BWR22_02600Help
Entry
BWR22_02600       CDS       T04680                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lvn  Lacinutrix venerupis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lvn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWR22_02600
  Amino acid metabolism
   00310 Lysine degradation
    BWR22_02600
   00380 Tryptophan metabolism
    BWR22_02600
Enzymes [BR:lvn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BWR22_02600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
596557..599313
Genome map
AA seq 918 aa AA seqDB search
MDKYSFLNAAHTAYFADLYEQYQLNPDSVEPSWRAFFQGYDFGTENYGMDGEIAEGVSTQ
IPEHVQKEFQVVKLIDGYRNRGHLFTKTNPVRERRKYAPTLEIENFGLTQNDLSTVFNAG
EILGIGSQTLQEIIKHLESIYCDSIGVEYMYIRKPEEIQWIQNKLNINDNQPKFSSDQKK
HILKKLNEAVSFESFLHTKYVGQKRFSLEGGEALIPALDAMIEKASDLGVEEFVMGMAHR
GRLSTLTNIFGKSAKDIFSEFDGKDYEEEVFDGDVKYHLGWTSKRQSDSGKEIRLSIAPN
PSHLETVGAVVEGIVRAKQDRFYKDNLSKVLPIVVHGDAAIAGQGLVYEVVQMAQLDGYK
TNGTIHIVVNNQVGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVHAALFALDF
RMQFKRDVFIDMLGYRKYGHNEGDEPRFTQPKLYKAIAKHANPRNIYADKLIAEGVINKD
HVKELEKAYKDSLEEKLDASRKEDKTIITEFMASTWEQFASVDEVEMMKPVDTKVSKDEL
AKITKVLSNLPEDKKFIRKIERLVQSRQKMFDDNQLDWAMAEHLAYGSLLTEGYSVRISG
QDVERGTFSHRHAVVKVEDSEEEIILHNNISDKQGNFYIYNSLLSEYGVVGFDYGYAMAS
PKTLTIWEAQFGDFSNGAQIMLDQYISAGEDKWKTQNGLVMLLPHGYEGQGAEHSSARME
RYLQLCAKDNMYVADCTTPENMFHLLRRQMKSNFRKPLIVFTPKSLLRHPKCVSTVDSFA
NGSFKMVIDDEAVNVNKVKSLVFLTGKFYYDLDEEREKLGRDDIAFVRIEQLFPLPVEDI
KKVIEKYNGVDEIVWAQEEPRNMGAYSHMLMHLDEAKTFRLASRRAYGAPAAGSSTRSKK
RHQEVIDYVFDKTKNNQR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgcagcacacacagcatattttgctgatttatatgaa
caataccaattaaaccctgattctgtagagccaagttggagagccttttttcaaggttac
gactttggtactgaaaattatggtatggatggagaaattgccgaaggcgtttctacacaa
attccagaacatgttcaaaaagaatttcaggttgttaaacttatagatggttaccgtaat
agaggtcacttatttacaaaaaccaatcctgtaagagagcgtagaaaatacgcgcctact
ttagaaattgaaaattttggattaactcaaaatgatttatctacagtttttaatgcagga
gaaattttaggtattggctctcaaacattacaagaaattattaaacacttagaaagtatt
tattgcgattctataggtgttgaatatatgtatattagaaaacctgaagaaattcaatgg
attcaaaataagctgaatattaatgataatcagccaaaattttcttcagatcaaaaaaag
cacatattaaaaaaacttaatgaagcagtgtctttcgagagttttttacatacaaaatat
gtagggcaaaagcgtttttctctagaaggaggagaagctttaattccggctttagatgct
atgattgaaaaagcatcagacttaggtgtagaagaatttgttatgggaatggcacataga
ggtcgtttaagtacattaacaaatatttttggtaaaagtgcaaaagacatttttagcgag
tttgatggtaaagattatgaagaagaggtttttgatggagatgtaaaataccacctaggt
tggactagtaaaagacaatccgattcaggaaaggaaataagattaagtattgctccaaac
ccatcacatttagaaactgttggtgcggttgtagaaggaattgtaagagcaaaacaagat
cgtttttataaagacaaccttagtaaagtattgccaatagtagttcatggagatgccgca
atagcaggacaaggtttagtgtacgaggttgtgcaaatggcacaattagatggttataaa
accaacggtacaatacacatagttgtaaacaaccaagttggttttacaacaaactattta
gatgctagatcaagtacgtattgtacagatgttggtaaagttactttatcaccagtatta
catgttaatgccgatgatgccgaagctgtagtacacgccgctttatttgcattagatttt
agaatgcaatttaagcgtgatgtatttatagatatgttgggttatagaaaatatggtcat
aacgaaggagatgaacctcgttttacacaaccaaaattatataaagcgattgcaaaacac
gccaatccaagaaatatatatgcagacaaattaatagcagaaggtgttattaataaagat
catgtaaaagaattagaaaaagcatataaagatagtttagaagaaaaactagacgcatca
agaaaagaagataaaacaattattacagaattcatggcatctacttgggagcaatttgca
tcggtagatgaggtggaaatgatgaaacctgtagatacaaaagtgtctaaagatgaatta
gctaaaataactaaagttttatctaacttaccagaagataaaaagttcattcgtaaaatt
gaaagactagtgcaatcacgccaaaaaatgtttgacgacaatcaattagattgggcaatg
gcagagcatttagcatatggatcattattaacagaaggttatagtgttagaatttctggg
caagatgtagaacgtggaacgttttcacatagacacgctgttgttaaggtagaagatagc
gaagaagaaattattttacataataatataagcgacaaacaaggtaatttttacatatat
aactcattattatcagaatatggtgtagtaggtttcgattatggttatgccatggcaagc
ccaaaaacattaaccatttgggaagcacagtttggagactttagtaatggtgcacaaata
atgttagaccagtatatttcggctggagaagataaatggaaaacacaaaacggtttagta
atgttgctgccgcacggttacgaagggcaaggagcagagcattcttctgcaagaatggaa
cgttatttacaactttgtgctaaagacaatatgtatgtagcagattgtacaactccagaa
aacatgtttcacttgttgagaaggcaaatgaaatctaattttagaaaaccattgatagtt
ttcacaccaaaaagtttattacgtcatccaaaatgtgtatctacagtagattcttttgca
aatggaagctttaaaatggtaattgatgatgaagcggtaaacgtaaataaagtaaaatct
ttagtatttttaacaggaaaattttattacgatttagacgaagaacgtgaaaaactagga
agagatgatattgcctttgttagaatagagcaactattccctctaccagttgaagatatt
aaaaaggtaatagaaaaatacaatggcgtagacgaaattgtttgggcgcaagaagaacca
agaaatatgggagcttacagccatatgttaatgcatttagatgaagcaaaaacatttagg
ttagcatcaagaagagcatatggagcaccagcagctggaagtagcacaagatcaaaaaag
cgtcatcaagaagtaatagattacgtatttgataaaacaaaaaataatcagcgctaa

DBGET integrated database retrieval system