KEGG   Lacinutrix venerupis: BWR22_12000Help
Entry
BWR22_12000       CDS       T04680                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lvn  Lacinutrix venerupis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWR22_12000
   00020 Citrate cycle (TCA cycle)
    BWR22_12000
   00620 Pyruvate metabolism
    BWR22_12000
Enzymes [BR:lvn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BWR22_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2645545..2647182)
Genome map
AA seq 545 aa AA seqDB search
MAEVINMPRLSDTMEEGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGETAKVDSLLAIIGEEGEDISGLLEGGSAEEKPTENKSKEEDKVEEESDNSTATEST
SESLPEGVVVVTMPRLSDTMEEGTVATWLKKVGDTVEEGDILAEIETDKATMEFESFQSG
TLLHIGLEEGDSAKVDSLLAIIGPEGTDVSSVAKNFSVEGASAKKEEAPKKETPKKEAPK
TEAKKEAPKASASTSNSTPDGGRVFVSPLAKKMAEEKGIQLNHVKGTGENGRIVKRDIEN
FTSTQASSASAAKFVPTGQEDFDEVPNSNMRKAIAKNLAKSKFTAPHYYLNVEFDMENAI
AFRKQYNSVPDTKISYNDIVVKACALALKQHPQVNSQWFDDRMKLNNHVHIGVAVAVPDG
LLVPVVKFANEQTLPQIGAAVREYAGKARNKKLALDEMEGSTFTVSNLGMFGIDSFTSII
NQPNSAILSVGNIVEKPVVKNGQIVVGNTMKLCLACDHRTVDGATGAQFLQTLKGYIENP
VTMLV
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaatatgccgcgtttaagcgacacaatggaagaaggaactgtagca
agttggcttaaaaaagtaggtgataaagtagaggaaggcgatatattagctgaaattgaa
acagacaaagctaccatggaatttgaatcttttaatgaaggtacattacttcatattggt
attcaagaaggagagacagcaaaagtagattcacttttagctattattggagaagaaggt
gaagatatttcaggtttattagaaggcggttctgcagaagaaaaaccaacagaaaataaa
tctaaagaagaagataaagttgaagaagagtctgataactcaacagcaaccgaatcaaca
tctgaaagtttaccagaaggagttgttgttgtaacaatgccacgtttaagtgatactatg
gaggaaggtactgtagcaacttggttaaagaaagttggtgatacagtagaggaaggcgat
attcttgcagaaatagagacagataaagcaacaatggagtttgaatcttttcagtctgga
actttacttcatataggtttagaagaaggagattctgctaaagtagattcgcttttagca
attattggccctgaaggaacagatgtgtcttctgtagcaaaaaacttttcagtagaaggt
gcttcagctaaaaaagaagaagcaccaaaaaaggaaacgcctaaaaaggaagctccaaaa
acagaagctaaaaaagaagcacctaaagcttcagcttcgacatcaaattctacaccagat
ggtggtagagtatttgtttcacctttagctaaaaaaatggcagaggagaaaggtattcag
cttaatcacgttaaaggaacaggagaaaatggtcgtattgtaaagcgagatatagaaaac
tttacttctactcaagcatcatcggcatcagcagctaaatttgtacctactggtcaagaa
gattttgatgaagttccaaactctaacatgcgtaaagctattgctaaaaacttagcaaaa
tctaaatttactgcaccacattactatttaaatgtagagtttgatatggaaaatgctatt
gcttttagaaagcaatacaattctgtaccagatacaaaaatatcttataatgatattgtt
gtaaaagcatgtgcattagctttaaaacaacatccacaggttaactctcagtggtttgac
gatagaatgaaattaaataaccatgtacatattggtgttgcagtagcagtaccagacggt
ttattagtaccagtagttaaatttgctaacgagcaaactttaccacaaattggtgcagcg
gttagagaatatgctggtaaggcaagaaataaaaaacttgctttagacgaaatggaaggt
agtacttttactgtttctaatttaggaatgtttggtatagatagttttacttctattatt
aatcaacctaattcagcaattttatctgttggaaatattgtagagaagccagtagttaaa
aacggacaaatagttgttggtaatacaatgaaattatgtttagcttgcgaccatagaacg
gtagatggagcaacaggagcacaatttttacaaacattaaaaggatatattgaaaatcca
gttacaatgctagtataa

DBGET integrated database retrieval system