KEGG   Loktanella vestfoldensis: LOKVESSMR4R_02055Help
Entry
LOKVESSMR4R_02055 CDS       T04854                                 

Gene name
ligB
Definition
(GenBank) DNA ligase B
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lvs  Loktanella vestfoldensis
Pathway
lvs03030  DNA replication
lvs03410  Base excision repair
lvs03420  Nucleotide excision repair
lvs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lvs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LOKVESSMR4R_02055 (ligB)
   03410 Base excision repair
    LOKVESSMR4R_02055 (ligB)
   03420 Nucleotide excision repair
    LOKVESSMR4R_02055 (ligB)
   03430 Mismatch repair
    LOKVESSMR4R_02055 (ligB)
Enzymes [BR:lvs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LOKVESSMR4R_02055 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     LOKVESSMR4R_02055 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LOKVESSMR4R_02055 (ligB)
DNA replication proteins [BR:lvs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LOKVESSMR4R_02055 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LOKVESSMR4R_02055 (ligB)
DNA repair and recombination proteins [BR:lvs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LOKVESSMR4R_02055 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     LOKVESSMR4R_02055 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     LOKVESSMR4R_02055 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ARU01365
UniProt: A0A1Y0ECM9
LinkDB All DBs
Position
2065418..2067007
Genome map
AA seq 529 aa AA seqDB search
MKAFAALFAQLDESTKTSVKVAALAAYFRTAPDSDKLWTLALFTGRRPKRVITASKLRLW
AAEVAGLPDWLFEESYSIVGDLAETIALVLPPPRATSDESLTYWIMHLRALGMQDEEVRK
AGIIAAWDRLPPAERFLFTKLLTGGFRIGVSAKLMIRALAQATGQPEPELTHRLMGNWTP
DNVTWTSLIEADDPGTDASRPYPFYLAYGLEDLDALGPPADWSAERKWDGIRGQFILRGS
NHYLWSRGEDLMTDRFPELAQLCDALPDGTVIDGEVLAFADDAPLPFAALQKRIGRKTVP
RKLLAEAPVILMAYDLLELDRSDIRQQPFAERRAHLARLVARVSTRAPLRLSPQVTFTTW
DDLAAEREKSRDLGAEGLMLKRHDSPYLAGRKKGDWWKWKVDPLTIDAVMIYAQSGSGRR
ANLFTDYTFAVRDGDALVPFTKAYSGLTDVEFRQITAWVRKNTLQKFGPVRQVPPVHVFE
IAFEGISESPRHKSGVALRFPRMLRWRQDKPLAEANTLDDLREMLRLYG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttgccgcccttttcgcccaacttgatgaaagcaccaagaccagcgtcaag
gtcgcggccctggccgcgtatttccgcaccgcccctgacagcgacaagctctggaccctg
gcgcttttcaccgggcgcaggccgaaacgggtgatcacggcgtccaaattgcggctctgg
gcggccgaggtcgcaggcctgcccgattggctgttcgaggaaagctacagcatcgtgggc
gatctggcggaaaccatcgcgctggtgctgcccccgccgcgcgccaccagcgacgaaagc
ctgacctattggatcatgcatctgcgcgccttgggcatgcaggacgaggaggtgcgcaag
gccggcatcatcgccgcttgggaccggctgccgcctgcggaacggtttttattcaccaag
cttttgacaggcggttttcgtatcggggtcagcgcgaaactgatgatccgcgcgctggcg
caggccacaggccagccggaaccggaattgacccataggctgatgggcaattggaccccc
gacaatgtcacctggaccagcctgatcgaggcggatgacccgggcaccgatgcgtcccgc
ccctatccgttctatctggcttacgggctcgaggatctagatgccctcggcccgcctgcc
gattggtcggcggaacgcaaatgggacgggatcagggggcaattcatcctgcgcggcagc
aatcattacctatggtcgcgcggcgaggatctgatgaccgaccgctttccagagcttgcg
caattatgcgacgccctgcccgatggcaccgtcattgacggcgaggtactggcctttgca
gatgatgcccccctgccctttgccgccttgcaaaaaaggatcgggcgcaaaaccgtgccg
cgcaaattgctggccgaagcgccggtgatcctgatggcctatgatctgctggaactggac
cgcagcgacatccgccagcagccctttgccgaaagacgcgcgcatctggcgcggcttgtt
gcgcgggtttcaacccgcgcgcccctgcggttgtcaccgcaggtgacattcaccacatgg
gacgatctggccgcagaacgcgaaaaatcccgcgatctgggggcggaagggctgatgctg
aaacgccatgacagcccctatctggccggtcgcaagaaaggcgattggtggaaatggaag
gtcgatccgctgaccatcgatgccgtgatgatctatgcgcaatcgggcagcgggcggcgg
gcgaacctgttcaccgactacacattcgccgtgcgcgacggcgatgcgctggtgcctttc
accaaagcctattccggcctgactgacgtggaattccgccagatcaccgcttgggtgcgc
aagaacacgctgcaaaaattcggccccgtccggcaggtgccgccggtccatgtcttcgag
atcgcctttgaaggcatcagcgaaagcccgcgccacaaatccggcgtcgccttgcggttt
ccgcggatgctgcgctggcggcaggacaaacccctggccgaggccaatacgctggacgat
ctgcgcgaaatgctgcggctttacggctga

DBGET integrated database retrieval system