KEGG   Listeria welshimeri: lwe1456Help
Entry
lwe1456           CDS       T00422                                 

Gene name
sod
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lwe  Listeria welshimeri
Brite
Enzymes [BR:lwe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lwe1456 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAK20874
UniProt: A0AIP2
LinkDB All DBs
Position
complement(1453997..1454605)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVANHPELASKPVEELVAN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaacaatggaaattcactatacaaagcaccacaatacttatgtaactaaattaaat
gaagcagttgctaaccatccagaattagcaagcaaacctgtcgaagagttagttgctaac
ttagatagcgttcctgaagatattcgcggcgctgtccgtaatcacggtggcggtcatgct
aaccatactttattctggtctatccttagcccaaatggtggcggtgctccaactggtaac
ttaaaagcagcaattgaaagcgaatttggcacatttgacgaattcaaagaaaaatttaac
gctgcagctgcagcacgtttcggttctggttgggcttggctagtagtaaacaacggtaaa
ttagaaatcgtttctacagcaaaccaagattctccacttagtgatggcaaaacgcctgta
ttaggtctagatgtttgggaacatgcttactacctaaaattccaaaaccgtcgtcctgaa
tacatcgacacattttggaatgtaattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system