KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx10330Help
Entry
Lxx10330          CDS       T00190                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00473  D-Alanine metabolism
lxx01100  Metabolic pathways
lxx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Lxx10330 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Lxx10330 (alr)
Enzymes [BR:lxx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Lxx10330 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:lxx01011]
 Precursor biosynthesis
  Racemase
   Lxx10330 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_C Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: AAT88897
UniProt: Q6AFE8
LinkDB All DBs
Position
complement(1054682..1055392)
Genome map
AA seq 236 aa AA seqDB search
MTPAPGVRRHAHIDLDAIVANAISSGRPLTDSTADLRVDAYGHGLIPVARVLSSAGTGGF
LVSRVEDAATLADDGVPGRILVGSTAVDAGALLGPELFGLDPRHPSRLALRLVGEIVAVK
RVAARRGVSYGYTYRTERPSTLVLVALGYADGLLRVASNRGPVQVGTVRGRVSGRIAMDQ
FVVDIGDADTLPGDPVVVFGDPGRGEPTVLDWADALGVAAPVITSRLGRRIERRYA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggcccccggcgtgcgcaggcacgcgcacatcgatctcgacgccatcgtcgcg
aacgcgatctccagcgggcgaccactcaccgattccaccgccgacctccgcgtcgacgca
tacggccacgggctcattcccgtggcgcgtgtactgtcgtcggccgggaccggcggtttt
ctggtctcccgggtcgaggacgctgcgacgctggccgacgacggtgtgccggggcgtatc
ctggtcggctccaccgcggtcgacgccggcgcgctgctgggaccagagctgttcggcctc
gacccccggcatccctcccgtctcgcgctgcgcctcgtcggggagatcgtcgcggtcaag
cgggtcgccgcgcgccgcggggtgtcctacggctacacctaccgcaccgagcgcccgagc
accctggtcctggtggcgctcggatatgcggacggcctcctgcgcgtcgcctcgaaccgg
gggcccgtgcaggtcggaaccgtccgcgggcgcgtgagcggacgcatcgcgatggatcag
ttcgtggtcgacatcggggacgccgacacgctccccggcgacccggtcgtcgtcttcggc
gacccgggccgcggcgagcccaccgtcctcgactgggcggatgccctgggcgtcgccgcc
cccgtcatcaccagccggctcggccggcgcatcgagagacgctacgcatga

DBGET integrated database retrieval system