KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx11510Help
Entry
Lxx11510          CDS       T00190                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Brite
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Lxx11510 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1187250..1187876
Genome map
AA seq 208 aa AA seqDB search
MADYTLADLPYDYSALEPNISGRIMELHHDKHHKTYVDGANTALAQLAEARDADNLTYVN
KLQKDLAFNLAGHVNHTVFWNNLSPEGGDKPDGELAAAIDEFFGSFDKFRAHFTASALGI
QGSGWSILAWDSLSQKLIIEQLYDHQANLAAATVPLLLIDMWEHAFYLDYVNVKADYVKA
FWNIVSWADVGQRFVRARQSTSGLLVLS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacacgctcgccgatcttccctatgactattcggctctcgagccgaacatc
agcggtcggatcatggagctccaccatgacaagcaccacaagacctatgtcgacggtgcg
aacaccgcgctcgcccaactcgccgaggcccgcgatgcggacaacctcacttacgtgaac
aaactgcagaaagacctcgccttcaacctggccggtcacgtcaaccacacggttttctgg
aacaacctctcgccggaagggggggacaagccggacggcgaacttgccgcggcgatcgac
gagttcttcggatcgttcgacaagttccgcgcccatttcaccgcgtcggcgctcggcatc
cagggctccggctggtcgatcctcgcctgggattcgctcagccagaagctcatcatcgag
cagttgtacgaccaccaggccaacctcgcggcggcgaccgtccccctgctcctgatcgac
atgtgggagcacgccttctacctcgactatgtcaatgtgaaggcggattacgtcaaggcg
ttctggaacatcgtcagctgggccgatgttggccagcgcttcgtccgggcgcgccagagt
acctcgggtctgctggtactctcatag

DBGET integrated database retrieval system