KEGG   Martelella sp. AD-3: AZF01_20795Help
Entry
AZF01_20795       CDS       T04332                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
maad  Martelella sp. AD-3
Pathway
maad00250  Alanine, aspartate and glutamate metabolism
maad00410  beta-Alanine metabolism
maad00430  Taurine and hypotaurine metabolism
maad00650  Butanoate metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
maad01120  Microbial metabolism in diverse environments
maad02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:maad00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AZF01_20795
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZF01_20795
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZF01_20795
   00430 Taurine and hypotaurine metabolism
    AZF01_20795
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AZF01_20795
Enzymes [BR:maad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AZF01_20795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMM87032
UniProt: A0A127CQ98
LinkDB All DBs
Position
4491583..4492977
Genome map
AA seq 464 aa AA seqDB search
MAEEREQDGLFDPNDETYGAADLSAILPKSGFPEKERAPRLAYAAIHDELLLDGNARQNL
ATFCQTWEEPEIHKLMDDCIDKNMIDKDEYPQTAEIEARCVRMLGDLWHAPEGPVTGTST
TGSSEAAMLGGLAMKRRWEARRKAEGKPTDKPNLITGPVQICWHKFTRYWDVEHREIPME
NGRLLMTPEEVLELCDENTIGVVPTLGVTYTGEYEPVKAVSDALDDLQARTGLDIPIHVD
GASGGFLAPFCAPELEWDFRLPRVKSINASGHKFGLSPLGVGWVLWREDKDLPEEMVFWV
NYLGGNMRDIALNFSRPGGQVICQYYNFLRLGRQGYRKVHEACYRSAAFLAEELEKTGLV
DIVFDGDMKKGIPAVSWKLKDGLKTNYTLFDLADRLRTRGWQVPAYTLPANCQDQAIQRI
LVRNGVSIDLCSLLIEDIKAAVDYFKAHPISTPLTEDEASGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaacgcgaacaggacggtctgtttgatcccaatgacgagacctacggcgct
gccgatctttcggcgatcctgccaaagtccggctttcccgagaaggagcgcgcgccgcgt
cttgcctatgcggcgatccatgacgaactcctgcttgacggcaatgcccggcagaatctc
gcgaccttctgccagacctgggaggagcccgagatccacaagctgatggatgactgcatc
gacaagaacatgatcgacaaggacgagtacccgcagacggccgaaatcgaggcgcgctgc
gtgcggatgctgggcgatctctggcatgcgccggaaggcccggtcaccgggacgtcgacc
accggctcgtccgaagccgcaatgctcggcgggcttgcgatgaagcgccgctgggaggca
aggcgcaaggcagaaggcaagccgaccgacaagcccaacctgatcaccggcccggtgcag
atctgctggcacaagttcacccgttactgggatgtcgaacatcgcgagatcccgatggaa
aacggccgcctgctgatgacgccggaagaggtgctagagctctgcgacgaaaacacgatc
ggcgtggtgccgacgctcggcgtcacctataccggcgaatacgagccggtgaaggccgtt
tccgacgcgctcgacgatcttcaggcgcgcaccgggcttgatatcccgatccatgtggat
ggggcgagcggcggcttcctggcgcccttctgcgcgccggaactggaatgggacttccgc
ctgccgcgcgtgaaatcgatcaatgcgtcgggtcacaagttcggcctctcgccgctcggc
gtcggctgggtgctgtggcgcgaggacaaggacctgcccgaggaaatggtcttctgggtc
aattatctgggcggcaacatgcgcgacatcgcgctcaatttctcccgccccggcggccag
gtaatctgccagtactacaatttcctgcggcttggccgtcagggttatcgcaaggtgcac
gaggcctgctaccgcagcgccgcctttctggcggaggaactggaaaagaccggcctcgtc
gatatcgtctttgacggcgacatgaagaagggcattccggccgtctcgtggaagctcaag
gacggccttaaaaccaattacaccctgtttgatctcgccgaccggttgcgcacgcgcggc
tggcaggtgccggcctatacgctcccggccaattgccaggatcaggcgatccagcgcatt
ctggttcgaaatggcgtgtcgatcgacctctgctcgctgctgatcgaggacataaaggcg
gcggtggattacttcaaggcgcacccgatcagcacgccgctgaccgaggacgaggcctcc
ggcttccaccattga

DBGET integrated database retrieval system