KEGG   Mycobacterium abscessus ATCC 19977: MAB_0823Help
Entry
MAB_0823          CDS       T00657                                 

Definition
(RefSeq) Probable aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MAB_0823
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MAB_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
818171..819631
Genome map
AA seq 486 aa AA seqDB search
MHINEIQSFVGGRWISGGGQAVISVCPAFPDRVIAEGLAAGPAEFDEAAAAARAAQPGWA
AMSLHARGAMLSHAAAVVDRNADAWGLELAAEEGKTKAEGIAEVRRAAQILRYYGNEGDR
QTGEIFSSPRRGEHILVTRKPLGVVGVITPFNFPIAIPAWKIAPALVYGNAVLWKPASTV
PLLAMRLAQAFDAAGLPPGVLNLVVGDTGVGDAMVNDSRVDALTFTGSTGVGRRIAAAGA
ARGIPVQAEMGGKNAAVVLDDADVDLAVEQVLLGAFRSTGQKCTATSRLVLTEGIADAFL
SLLKDRADALVVGDPTADDTQMGPVVSESAFGTITAGIGGAVAQGAVTLAGGHGYGDGPL
AAGYFIAPTIMELGMGAVDLWTEELFGPVLAVRRAADTEEAFRLANDSEYGLSAAIFTKD
LTRALSAVDHVDVGILHVNSESAGADPHVPFGGAKKSGLGPKEQGRAAREFFTHTTTVYL
RGEEAM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaatgagattcaaagttttgtgggtggccggtggatcagcgggggcggccag
gcggtgatcagcgtgtgccccgcatttcctgaccgggtcatcgccgaagggctggctgcg
gggccggcggagttcgatgaggccgccgcggcggcgcgcgcggcgcagcccggttgggcc
gccatgtccttgcacgcgcggggcgcgatgttgtcgcacgctgccgcggttgttgaccgt
aacgccgatgcctggggcctggaacttgctgcggaggaggggaaaaccaaggcagagggc
atcgcggaggtgcggcgggccgcgcagatcctgcggtactacggcaacgagggcgaccgg
cagactggggagatcttcagttcaccgcgacgcggtgaacacatcctggtgacccgcaag
ccccttggagtcgtgggcgtaataaccccattcaattttcctatcgccataccggcctgg
aagatcgcccccgcattggtatatggcaacgccgtgctgtggaagccggcgagcacggtc
ccgctgttggccatgcgtcttgcccaggcatttgatgccgctgggctgccacctggcgtg
ttgaacctcgtcgtcggggatacaggtgtcggtgatgccatggtgaatgacagccgagtc
gatgccctcacgttcacgggttcaaccggcgtcggtcggcgtattgcggcggcaggggcg
gcgcggggcataccggtccaagcggaaatgggtggcaagaacgccgccgtcgttctcgac
gatgccgacgtcgacctcgccgtggagcaggtactgctgggcgccttccgctcgacggga
caaaagtgcaccgccacgtctcggctggtgctcaccgagggcatcgcggatgcgttcctg
tcgttgctcaaggatcgcgcggacgcgctggttgtcggcgatcccaccgcagacgacacc
cagatgggcccggtggtcagcgagtccgcgttcggcacgatcaccgcggggatcggcggc
gcggtcgcacagggtgcggtcacccttgccggtgggcacggctacggggacggccccctg
gccgccggctacttcatcgcgcccaccatcatggaactcggtatgggagcggtggacctc
tggaccgaggaattgttcggcccggttttggcggtgcgccgcgccgcagacaccgaggag
gcattcaggttggcgaacgacagtgagtacggtttgtccgcagcgatattcacaaaagac
ctcacccgggccttatcggcggtcgaccacgtggacgtgggcatcctgcatgtgaattcg
gaatccgctggcgcagacccgcatgttccgttcggaggcgccaagaagagcgggctaggc
cccaaggaacagggccgggccgcgcgggagttctttacccacaccaccaccgtgtacctg
cgcggtgaggaggcaatgtga

DBGET integrated database retrieval system