KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3909Help
Entry
MAB_3909          CDS       T00657                                 

Definition
(RefSeq) Putative peroxidase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 5966372
NCBI-ProteinID: YP_001704637
UniProt: A0A2C9Y513
LinkDB All DBs
Position
3960754..3962556
Genome map
AA seq 600 aa AA seqDB search
MTEKAVPTRLASWFGTQIDRFIGWPRLPKMAGIAVLYTLRRALQSDNLFDSGRGALDAPQ
HDPGVADHRAARTIDGTYNNLDDPLMGSVGSRFGRNAPLDQTFPEPPDRLMEPNPRSVSR
RLLTRDEFVPATTLNALAAAWIQFEVHDWFSHGTTDSQPWDVPLESDDPWPQEQMRIRRT
PPDPSADASGPPTYVSQDTHWWDGSQLYGSNRVFADALRTGQGGRLRLDRLGLPPEDVEK
IASQSETAANFWVGLAILHSLFMREHNTICDHLGTAHPDMSDQQLYDTARLVNTAVMAKI
HTVDWTPAIIGHPTTVYAMHANWFGLFGERVAEFLRRGTRNALICGIPGSPTNLHDVPYS
LTEEFVAVYRMHPLIPDDFVFRSATDDSVIAEHTLPGLAMQHVRTRFREMSIEDLAYSFG
RAHPGALTLHNYPRHLQILERPDGSVLDLASIDVLRVRERGVPRYNDFRRMLRLRPASDF
NDLTDNPVWARELAAVYGDVERVDLMVGLYAEPKPKGFGFSDTAFRIFVLMATRRLEADR
FFTTDFRPEVYTPEGFAWVRSNSMRTVLLRHCPSLAPALDGVTNPFAPWRPVRTSNRSAR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaggccgttccgacgcggttggcttcgtggttcgggacgcaaatcgaccga
ttcatcgggtggccacggctacccaaaatggcagggatcgcggtgctgtacacgttgcgc
cgtgcgctgcagtcggacaacctgttcgactccggacgcggggcactcgacgcaccacag
cacgacccaggtgtcgctgatcatcgcgctgcccgcacgattgacggcacctacaacaat
ctcgatgacccactcatggggtctgtgggcagccgattcggacgcaatgcaccgctggat
cagacctttccggaaccacccgatcgcctgatggagcccaacccgcggtcggttagccgt
cgtttgctcacccgagacgaattcgtaccggcgacaaccctcaacgcacttgcggcggcg
tggattcagttcgaggtgcacgactggttcagccatgggacgaccgacagtcaaccgtgg
gacgtgcccctggaatcagatgacccgtggccacaggagcagatgcggattcgccggacg
ccgccggatccatctgccgacgcctcaggcccgcccacctacgtcagccaggacacgcat
tggtgggacggctctcagctctacggcagcaatcgggttttcgccgacgccttgcgcacc
gggcagggcggacggctgcgcctggaccggctcggcctgcctcccgaagacgtcgagaag
atcgccagccaatccgagacagccgccaacttctgggtgggcctggcgatcctgcactcg
ctgttcatgcgcgaacacaacaccatctgcgaccatctgggcaccgcccacccggacatg
tcggatcagcagctgtacgacacggcccggctggtcaatacggcggtgatggcgaagatc
cacacggtggactggacaccggcgatcatcggtcaccccaccaccgtgtacgccatgcat
gccaattggtttggcctgtttggcgaacgtgtcgccgagttcctgcggcgcgggactcgc
aacgcattgatatgcggcattcccggctctccgaccaacctgcatgatgtcccgtactcg
ctcaccgaagaatttgtggcggtgtaccgcatgcatccactcattcccgatgacttcgtg
ttccgttcggccaccgacgattctgtgatcgcggagcacacgttgccgggattggcgatg
cagcatgtgcgcacccggttccgtgagatgtcaatcgaggatctggcctactccttcggc
cgcgcccacccgggtgcgctgacattgcacaactaccccaggcatcttcaaattctcgaa
cgccccgatggatcggtgctggacctggcttcgatcgatgtgctgcgggtgcgtgaacga
ggcgtgccgcgctacaacgacttccggcgaatgctgcggctgcggccggcctcggatttc
aacgacctcaccgacaacccggtgtgggctcgcgaactcgccgccgtctatggcgatgtg
gagcgcgtcgacctgatggtagggctatacgccgagcccaagccgaagggtttcggcttc
agcgacaccgcctttcggatattcgtcctcatggctacccggcgcctggaggccgaccgg
ttcttcaccaccgatttccgccctgaggtatacacccccgagggcttcgcgtgggtcaga
tccaattcgatgcgcacggtgctgctacggcactgcccgtccttggcaccggcactggac
ggtgtgacgaatcccttcgcgccctggagaccggtgcggacgtcgaacaggagtgcacga
tga

DBGET integrated database retrieval system