KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_0281Help
Entry
MASS_0281         CDS       T02682                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(311956..313020)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPE
LVAAVLAELPPRCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLL
ALGDEDYTGRPFSERRAALAEALSGAGASIHLTPATTDQALAQRWFEEFEGAGTDGLIAK
PLAIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGDNAIGSLLLGLYQEDGVLASVGVIG
AFPMAERKRLFQELQPLVIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctccaatcgcgccaatgcttgccaaacctgtcgcaaaaatc
cctgacggcgcctcctacgaacccaagtgggatggattcaggtcgatcgtctttcgcgac
ggcgacgaggtggagctgggtagccgcaacgagaagccactgacccggtacttccccgag
ttggtagcggcggtgctcgccgaactaccgccacggtgtgtcgtcgacggtgagatcgtg
atcgccaccgaagcgggtctggatttcgaggcgctgcaacaacggatccacccggctgat
tcgcgggtacggctattggccgagcagacaccctcctccttcatcgcattcgacctgctc
gccttgggcgacgaggactacaccgggcggcccttcagcgagcgccgtgccgcgctggcg
gaggcattgtccggcgcgggtgcgtcgattcacctcacgcccgccaccacagatcaggca
ctggcgcagcgctggttcgaggaattcgagggcgccggcaccgacggtctcatcgcgaag
ccgttggccatcgcctaccaacccgacaaacgagtgatgttcaagataaagccggagcga
accgcggattgcgtggtcgcgggctaccgagtgcacaaatcgggtgacaatgccatcggc
tcgctgctgctgggcctgtaccaggaggacggcgtattggcgtcggtcggtgtgatcggc
gcgttccctatggccgaacgcaagcgcctattccaagaactacaaccgttggtcatcccg
ctcgaaaatcacccatggaactgggccgcacacgaagccggcgagcgcactccgcagaag
aacgccggctcccgctggaacgcgggcaaggatctttcgttcgtcccgctgcgtcccgag
cgggtggtggaggttcgctacgaccacatggagggtgtgcggttccgccataccgcgcag
ttcaaccgctggcgcccggatcgcgacccgcgatcctgcacctacgagcagctagaacaa
ccaattacattcagcctcaacgatattgttccaggtctggtgtga

DBGET integrated database retrieval system