KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_4698Help
Entry
MASS_4698         CDS       T02682                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4713688..4715361)
Genome map
AA seq 557 aa AA seqDB search
MSDTGIRQHVEINAPAMKSGAIDYLGLLRAGLEELDFYDSRRHLYTRAGADLVVDIRIRA
AALRERGLRRGDRVAMTATSDEEYLATLLAVLLLGAVPCAIAPPPTPSRPDSAGVAHLRA
ALEVLSPAMVIAQPRVMVAVVHPNVLSYDQLADANPIDWELLSTAHPADVHHIQLTSGST
SAPKAVVLTHGNVVHNASAIAYGTRASRGRDRVFSWLPFYHDMGFIQVLAALLYGLRVGV
MTPMGFLRDPISWLRHMSHHGSTHTAGPPFAYRAISDAIGRGGPLVDVDLSSLRHAYVGA
EPIPYPVVCDVTARLRLLGMRNDVLVPCYGMAETVLATSIALQPYPPGETAFGRVYGRRS
PENGQLVVSCGRPVDGLRVRVLSSDGEVLADGAVGDIQVSGPSVMRGYLRPDGGVVAPEG
GWHSTGDRGYLDGGELFVVGRRKEMLIVRGRNFPPYDVERQIDQLSGAGGVSVVFTVQDE
QRVRESVVAVVGTRAALCEYEGLRSRVAGGVRAAFGFSLDDVVVVPARVIPRTTSGKRQR
LKVREAYLSGLLSPAGG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacggggattcgtcagcacgtggagatcaatgcgccggctatgaagtccggc
gcgattgattatctcgggctgcttcgtgcgggactggaagagctcgatttctacgattcg
cgacgccatctgtacacacgtgcgggtgcagatctggttgttgacatccggatccgtgct
gcggcgctacgcgagcgtggactgaggcgcggtgatcgagtcgccatgaccgccaccagc
gacgaagaatacctggcgacactgttggccgtgctgttgttgggtgcggtgccctgcgcg
atcgcgccgccgcccactccctcgaggccggactccgcgggagtagcgcatcttcgcgcc
gcgcttgaggtgttgagccccgctatggtcattgcccagccacgtgtcatggtggcggtc
gtgcatccaaacgtgttgtcgtacgatcagcttgcggatgccaatcccattgactgggag
ctactttcgactgcacacccagcagacgtgcaccacatacagcttacctcgggctcgacc
tccgcgccgaaggcagtagtgctgacccatggcaatgtcgtgcataacgccagtgcaatc
gcctacggcacaagggcatcgcggggccgcgatcgggtgttcagctggctgcccttctat
cacgatatgggctttatccaggtgttggccgcactgctctacggtctccgagtgggggtg
atgaccccgatgggatttctgcgcgatccgatctcctggctacgacacatgtctcatcac
gggtcgactcacaccgcgggtccaccgttcgcgtatcgggcgatatcggacgcgatcggt
cgcggcggcccgcttgtagatgtggatctgtcctccctgcgtcatgcctacgtgggtgcc
gagcccatcccttacccggtggtgtgtgacgtcaccgcgcggcttcgtttgttgggtatg
cgtaacgacgtgttggtgccgtgctacggcatggcggaaacagtgctcgcgacaagcatt
gcgctgcaaccatatccaccgggagaaacagcattcggccgggtttacggccggcgtagt
ccggagaacggtcaattggttgtgtcgtgtggtcggccggtcgacggcttgcgggtgcgc
gtcctttcgtccgatggtgaagtacttgctgatggagctgtcggcgatattcaggtgagt
gggccgtcggtaatgcggggctacttgcgtcccgacggcggggtagtcgcgcccgagggc
ggatggcacagcactggtgaccgcggctatctcgacggcggtgaactctttgtggtgggg
cgtcgcaaggagatgctcatcgtgcgggggcgcaacttcccgccctacgacgtcgaacgg
caaatcgaccagctctctggtgccggtggagtttccgttgtgttcacggtgcaggatgaa
cagcgcgttcgcgagtcggttgtggccgtggtaggaacgcgggcggccttatgcgagtac
gagggactgcgtagccgtgtggccggtggtgtgcgcgcggcgttcgggttttcactggat
gacgtcgtcgtggtgccggcacgtgtgattccccggaccaccagcggaaaacgtcagcga
ctgaaggtgcgtgaggcgtatctgtccgggctgttgtcaccggccggaggctga

DBGET integrated database retrieval system