KEGG   Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300: MMASJCM_4725Help
Entry
MMASJCM_4725      CDS       T03694                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
mabl  Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4726323..4727969)
Genome map
AA seq 548 aa AA seqDB search
MEINAPAMKSGAIDYLGLLRAGLEELDFYDSRRHLYTRAGADLVVDIRIRAAALRERGLR
RGDRVAMTATSDEEYLATLLAVLLLGAVPCAIAPPPTPSRPDSAGVAHLRAALEVLSPAM
VIAQPRVMVAVVHPNVLSYDQLADANPIDWELLSTAHPADVHHIQLTSGSTSAPKAVVLT
HGNVVHNASAIAYGTRASRGRDRVFSWLPFYHDMGFIQVLAALLYGLRVGVMTPMGFLRD
PISWLRHMSHHGSTHTAGPPFAYRAISDAIGRGGPLVDVDLSSLRHAYVGAEPIPYPVVC
DVTARLRLLGMRNDVLVPCYGMAETVLATSIALQPYPPGETAFGRVYGRRSPENGQLVVS
CGRPVDGLRLRVLSSDGEVLADGAVGDIQVSGPSVMRGYLRPDGGVVAPEGGWHSTGDRG
YLDGGELFVVGRRKEMLIVRGRNFPPYDVERQIDQLSGAGGVSVVFTVQDEQRVRESVVA
VVGTRAALCEYEGLRSRVAGGVRAAFGFSLDDVVVVPARVIPRTTSGKRQRLKVREAYLS
GLLSPAGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcaatgcgccggctatgaagtccggcgcgattgattatctcgggctgcttcgt
gcgggactggaagagctcgatttctacgattcgcgacgccatctgtacacacgtgcgggt
gcagatctggttgttgacatccggatccgtgctgcggcgctacgcgagcgtggactgagg
cgcggtgatcgagtcgccatgaccgccaccagcgacgaagaatacctggcgacactgttg
gccgtgctgttgttgggtgcggtgccctgcgcgatcgcgccgccgcccactccctcgagg
ccggactccgcgggagtagcgcatcttcgcgccgcgcttgaggtgttgagccccgctatg
gtcattgcccagccacgtgtcatggtggcggtcgtgcatccaaacgtgttgtcgtacgat
cagcttgcggatgccaatcccattgactgggagctactttcgactgcacacccagcagac
gtgcaccacatacagcttacctcgggctcgacctccgcgccgaaggcagtagtgctgacc
catggcaatgtcgtgcacaacgccagtgcaatcgcctacggcacaagggcatcgcggggc
cgcgatcgggtgttcagctggctgcccttctatcacgatatgggctttatccaggtgttg
gccgcactgctctacggtctccgagtgggggtgatgaccccgatgggatttctgcgcgat
ccgatctcctggctacgacacatgtctcatcacgggtcgactcacaccgcgggtccaccg
ttcgcgtatcgggcgatatcggacgcgatcggtcgcggcggcccgcttgtagatgtggat
ctgtcctccctgcgtcatgcctacgtgggtgccgagcccatcccttacccggtggtgtgt
gacgtcaccgcgcggcttcgtttgttgggtatgcgtaacgacgtgttggtgccgtgctac
ggcatggcggaaacagtgctcgcgacaagcattgcgctgcaaccatatccaccgggagaa
acagcattcggccgggtttacggccggcgtagtccggagaacggtcaattggttgtgtcg
tgtggtcggccggtcgacggcttgcggctgcgcgtcctttcgtccgatggtgaagtactt
gctgatggagctgtcggcgatattcaggtgagtgggccgtcggtaatgcggggctacttg
cgtcccgacggcggggtagtcgcgcccgagggcggatggcacagcactggtgaccgcggc
tatctcgacggcggtgaactctttgtggtggggcgtcgcaaggagatgctcatcgtgcgg
gggcgcaacttcccgccctacgacgtcgaacggcaaatcgaccagctctctggtgccggt
ggagtttccgttgtgttcacggtgcaggatgaacagcgcgttcgcgagtcggttgtggcc
gtggtaggaacgcgggcggccttatgcgagtacgagggactgcgtagccgtgtggccggt
ggtgtgcgcgcggcgttcgggttttcactggatgacgtcgtcgtggtgccggcacgtgtg
attccccggaccaccagcggaaaacgtcagcgactgaaggtgcgtgaggcgtatctgtcc
gggctgttgtcaccggccggaggctga

DBGET integrated database retrieval system