KEGG   Mycobacteroides abscessus subsp. bolletii MC1518: NF82_18730Help
Entry
NF82_18730        CDS       T03499                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mabo  Mycobacteroides abscessus subsp. bolletii MC1518
Pathway
mabo00250  Alanine, aspartate and glutamate metabolism
mabo00410  beta-Alanine metabolism
mabo00430  Taurine and hypotaurine metabolism
mabo00650  Butanoate metabolism
mabo01100  Metabolic pathways
mabo01110  Biosynthesis of secondary metabolites
mabo01120  Microbial metabolism in diverse environments
mabo02024  Quorum sensing
Module
mabo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mabo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NF82_18730
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NF82_18730
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NF82_18730
   00430 Taurine and hypotaurine metabolism
    NF82_18730
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NF82_18730
Enzymes [BR:mabo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NF82_18730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIV14009
LinkDB All DBs
Position
complement(3775365..3776747)
Genome map
AA seq 460 aa AA seqDB search
MNASAFSPAYTGRLSTAPVPALRLPDEPMDPQAAYRFIHDELMLDGSSRLNLATFVTTWM
DPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADNLSTEDPSSAVGVSTIG
SSEAVMLAGLALKWRWRTKIGGTDGTGWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLP
MAKGRYVITPEQVLEVVDEDTIGVVGILGTTFTGELEPIAAICAALDKLAATPGKPDVPV
HVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRGKEHLPEDLV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMRCLSETARWFGDELGKS
EHFEVITDGSAIPVVSFRLKGKRPYTEFDISHSLRAFGWQVPAYTMPDDVTDIAVLRVVV
REGFSGDLARALRDDLNTVLKGLDELKPNGHFDEVQPFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atcaatgcctccgccttcagccccgcgtacaccggcaggctgtccacggcacccgtcccg
gcgctgcgactgcccgacgagccgatggatccgcaggccgcctatcggttcattcacgac
gagctgatgctcgacggcagctcgcggctgaacttggcgaccttcgtcacgacgtggatg
gatcccgaggccgaaaagctgatggccgagacgttcgacaagaacatgatcgacaaggac
gagtatccggcgacggccgcgatcgagtcgcgatgtgtggccatggtggccgacctgttc
catgccgacaacttgtccacggaggatccgtcctcggcggtaggggtgtcgaccatcgga
tcgagtgaggcggtcatgctggccgggctggccctcaagtggcgttggcgcacgaaaatc
ggcggtaccgacggcaccggctggaaggggcgcacacccaacctggtgatgggttccaac
gtgcaggtggtctgggaaaaattctgccggtacttcgacgtcgaaccgcgatacctgccg
atggccaagggccggtacgtgatcactcccgagcaggtgcttgaggtggtcgacgaggac
accatcggcgtcgtcgggatcctgggcaccacgttcaccggagagctggagccgatcgcc
gcgatctgcgcggcgctggacaagctcgctgctacacccggcaagcccgatgtgccggta
cacgtcgatgccgccagcggtggtttcgtggtgcctttcctgcatcccgaactgcactgg
gacttccggttgccgcgggtggtgtcgatcaatgtcagcggacacaagtacgggctgacc
tatcccgggatcggctttgtggtgtggcgcggcaaggagcatctgcccgaagacctggtg
ttccgggtcaactacctgggtggcgacatgccgaccttcaccctgaacttttcccgcccg
ggcaaccaggtggtggggcagtactacaacttcttgcggctgggccgggccggatatgca
caggtgatgcgctgtctgtcggagacggcacgctggttcggcgacgaactcggcaagagt
gaacatttcgaggtgatcaccgacgggtcggcgatcccggtggtgtcgttccggctcaaa
ggcaagcggccgtacaccgagttcgacatctcgcattcgttgcgggcatttggctggcag
gtgcctgcgtacaccatgcccgatgacgtcaccgatatcgccgtactgcgagtggttgtg
cgcgagggcttctcgggagatctggccagagcgctgcgcgatgatctcaacaccgtgctc
aagggactcgacgagctgaaaccgaacggacacttcgacgaggtgcagccgttcgctcat
tag

DBGET integrated database retrieval system