KEGG   Methanosarcina acetivorans: MA_4555Help
Entry
MA_4555           CDS       T00080                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mac  Methanosarcina acetivorans
Pathway
mac00630  Glyoxylate and dicarboxylate metabolism
mac01100  Metabolic pathways
mac01120  Microbial metabolism in diverse environments
mac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MA_4555 (rbcL)
Enzymes [BR:mac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MA_4555 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAM07894
UniProt: Q8THG2
LinkDB All DBs
Position
complement(5608659..5609945)
Genome map
AA seq 428 aa AA seqDB search
MRRDYVDPGYSPKDTDLICEFHIEPAAGISFEEASTHMAGESSIDSWTEISTLSPELAAR
LKPHVFYLDADTQTVRVAYSEDLFELGSVPQVLSAVAGNIFSMKIVDNLRLQDITFPKSM
LREFEGPNFGLPGVRDIVGVKDRPLVGTIVKPKVGLTSEMHAEVAYNAFAGGCDLVKDDE
NLTDQKFNGFEKRAELTLKIAEKAEAETGERKMYLCNITAPTCEEMIRRLHVLKDLGASY
AMIDIVPTGWTALQTLREAAADEGLALHAHRCMHSAFTRNPRHGVSMLLVAKLCRLIGLD
QLHIGTVVGKMHGDKDEVLSIRDECVLDTVPADPEQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKEVIMQFGGGIHAHPMGTAAGAAACRQALEASLEGISLQDYAKDHKELEA
ALGKWLEK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacgtagacccgggctacagcccgaaagacacggacctgatctgtgaa
ttccatattgaaccggcagcaggaatcagttttgaggaagcttccacccatatggcaggg
gaaagctccatcgattcctggactgaaatttccactcttagccccgagcttgcagccagg
ttgaaacctcacgtcttttacctggatgcggatacccaaactgttcgggtggcttattcc
gaggatctcttcgaactcggatccgtcccccaggttctgagcgcggtggcaggcaacatt
ttcagcatgaagattgtggacaacctgcgtcttcaggatatcaccttccctaaatccatg
ctccgggagtttgagggcccaaacttcgggcttcccggagttcgggatatcgtgggggtt
aaagacaggccccttgtcgggacaatcgtcaagcctaaggtcggtctgacctcggaaatg
catgctgaagttgcatacaatgcttttgccgggggctgcgaccttgtaaaggacgacgag
aacctgactgaccagaagttcaacgggtttgaaaagagggcggaactcaccctgaaaatt
gcggaaaaagcggaagctgaaacaggggagcggaaaatgtacctgtgcaatatcacggct
cctacctgcgaggaaatgatccggcgtctgcacgtgctaaaggacctcggggcaagttac
gccatgatcgacatcgtgcctacgggttggacagccctccagaccctccgggaagcagcc
gcagatgaaggcctggcgctccacgcccaccgttgcatgcattcggcattcacaaggaac
ccaaggcatggggtcagtatgctgctcgtagccaaactctgccggctgatcgggcttgac
cagctccatatcggtaccgtggtcgggaagatgcacggggataaggacgaagtcctttcg
atcagggacgaatgcgtgctcgataccgtacccgcagatccagaacagcatgtccttgcc
caggactggggagggctaaaaccgatgtttccggtagcatccggagggcttgcccctaca
atgatccctgacctttactctattttcggaaaagaagtcattatgcagttcggcggagga
atccatgctcacccgatgggcacggcagccggagccgctgcctgcaggcaggcccttgaa
gcaagccttgaaggcatcagcctgcaggactatgcaaaggaccacaaagaacttgaagct
gctctcgggaagtggctggagaaataa

DBGET integrated database retrieval system