KEGG   Macrococcus sp. IME1552: BHM04_08300Help
Entry
BHM04_08300       CDS       T05070                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
macr  Macrococcus sp. IME1552
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:macr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BHM04_08300
Enzymes [BR:macr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BHM04_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1614967..1616424
Genome map
AA seq 485 aa AA seqDB search
MTKNYTIMQYFEWHTNDDGNHWNRLKDEAAALKEKGFDAIWLPPATKADHVTNTGYSVYD
LYDLGEFDQKGQVRTKYGTKEELIAAIEALHEQDIKVYADVVLNHKAGADEAETVRVVEV
DPNDRNSEISEPFDIDAFTKFYFPGRNKKYSAFEWNYTHFNGTDYDHRTERTGIFKILGE
NKDWNENVDQEKGNFDYLMFTNVDYQHPDVRDETINWGKWFTDTLNIDGMRLDAVKHIES
YFIRDFIHAMREHRGQDFYFVGEFWNPDLEVNENFLDEAEYSLDLFDVRLHFNFKAASEG
GAAYDLRQIFDGTIVKENPEHAVTFVDNHDSQPGEALESFVKDWFKQSAYALILLREDGF
PCVFYGDYYGIGGDHPIDGKQTAIDPLLYVRKLKAYGQQDDYFDHPNVVGWVRRGYAEDK
SGCAVIINNSEQPAEKQMFVGEDRAGQTWYDYTDTIEEGVVIDEKGNGIFKVNPGSVSVY
CEKEA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaactacacaattatgcaatattttgaatggcatacaaacgatgacggtaat
cactggaacagattaaaggatgaagctgcagcactcaaagaaaaaggatttgatgcaatc
tggttgccacccgcaactaaagctgaccatgtaacgaataccggctatagcgtatatgat
ttatacgacttaggagaattcgaccaaaaaggacaggttcgaactaaatacggcacgaaa
gaagaattaatcgcagcaatcgaagcacttcatgaacaagatattaaagtttatgccgat
gtcgttctaaatcataaagctggtgctgacgaagctgaaactgtacgcgttgtagaagtt
gatccaaatgacagaaattccgaaatttcagagccatttgatatcgatgcgtttacaaag
ttctattttccgggtcgtaataaaaaatacagtgcatttgaatggaactacacgcatttc
aatggtactgattatgaccatcgtacagaacgaactggtatatttaaaattttaggcgag
aataaagactggaatgaaaatgtcgatcaggaaaaaggtaacttcgattatctaatgttt
acaaatgttgattaccaacatcccgacgtacgcgatgagacgatcaactggggaaaatgg
tttactgatacattaaatattgatggtatgcgtcttgatgctgttaaacatatcgagagt
tattttatacgtgattttatacacgcaatgcgtgaacatcgcggacaagatttctatttt
gtcggtgaattctggaatccggatcttgaagtgaacgagaactttttagatgaagctgaa
tatagcttagatttattcgatgtaagactacactttaactttaaagccgcttcagaaggt
ggcgctgcttatgatctacgtcaaatatttgatggcactatagttaaagagaaccctgaa
catgcagtaacctttgtagacaatcatgattctcaaccaggtgaagctttagaatcattt
gttaaagattggtttaaacaatctgcatacgcacttatcttacttcgtgaagatggtttc
ccttgtgtattctatggcgattattatggtatcggtggagatcatccaattgacggtaaa
cagacggcgattgatccgttactctatgtccgtaaattaaaagcttatggccagcaagat
gattacttcgatcatccaaatgttgtcggctgggttagacgtggatatgccgaagataaa
tcaggatgtgctgtcatcattaataacagtgaacaacctgccgaaaaacaaatgtttgtt
ggtgaagatcgtgccggacaaacttggtatgactataccgacacaattgaagaaggtgta
gtcatcgatgaaaaaggtaacggcatcttcaaagtaaatccaggcagtgtgtctgtatat
tgcgaaaaagaagcataa

DBGET integrated database retrieval system