KEGG   Methanococcus aeolicus: Maeo_0011Help
Entry
Maeo_0011         CDS       T00552                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00500  Starch and sucrose metabolism
mae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Maeo_0011
Enzymes [BR:mae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Maeo_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 ATG16 ALO CHASE3 F_actin_bind
Motif
Other DBs
NCBI-ProteinID: ABR55604
JGI: Maeo0011
UniProt: A6USY2
LinkDB All DBs
Position
12767..14509
Genome map
AA seq 580 aa AA seqDB search
MLISFNFEVHQPHRLNKYIKNGINIDKIKNTNNNNHNLWDRYIDVPLNKEVFNKVANKCY
IPTNRIMLDLIDKHDIKIAYSITGVFLEQAMEFNDEVLDLFKDLVKTGNVELIGETYHHS
LSSLFETHDEFKEDILRHKKLIKDLFNYKTEVFRNTELIYHNSIAKTVKDIGGFKGIFTE
GADRLLDWRSPNYVYDSLCGLNVLLRNYQLSDDVGFRFSCCGWEDYPLYADKYAKWLANT
PGDCINIYVDYETFGEHQWKETGIFEFLKELPNEIEKYSHLEYAKPTEILDKCRPKGEID
VFEFSALSWADTERDISAWLGNRLQKTSFDKLKSIREPLGRYIQTNNKNSKNNNSNTTDT
ATLDNDLYDEIMEYRIYKNLQTSDNFYYQCTKGFNDMDVHAYFSHFETPYDAFVAYMDIV
YDFKTHLTISQILEIYKEKLNRLNNELNELKELNKKENEDTSELNNIINDLKDKIKNMEL
QLNLKDENIQKLKEEGVNLVNKLKQYEKEIISKTENVKKEIMNLKKEHEQEIKKKENKLG
NNSYNIRNNDIQKDNNKNNKNNKNNSNNKNNKNSDFIIGS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgctaatttcatttaattttgaggtccatcaacctcatagattgaataaatatattaaa
aatgggattaatattgacaaaattaaaaatactaacaataacaaccataatttatgggat
agatatattgatgtgccattaaataaagaagtatttaataaagttgcaaataaatgctat
attcctacaaatcgaattatgcttgatttaatagataaacatgatattaaaatagcatac
agcataacgggggtatttttagaacaggcaatggaatttaatgatgaggtgctggactta
tttaaagaccttgtgaaaactggcaatgttgaattaattggggaaacataccaccattca
ttatcgtctttgtttgaaactcatgatgaatttaaagaagacatattaagacataaaaag
cttataaaggacttatttaattataaaacagaggtatttagaaatactgaattaatatat
cataatagcatagctaaaactgtaaaggacataggaggatttaaaggtatatttacagag
ggcgcagatagattgcttgattggaggtctccaaattatgtatatgattcactttgtggt
ttaaatgttcttttaaggaattatcaattaagtgatgatgttggttttagattttcgtgt
tgtggttgggaagattatccattatacgccgataaatatgcaaaatggcttgcaaatact
cctggagactgtataaatatttatgtggattatgaaacatttggagaacatcaatggaaa
gaaacagggatttttgaatttttgaaggagctccccaatgaaattgaaaaatactcccat
cttgaatatgcaaaacctactgaaatattggataaatgtaggccaaagggggaaattgat
gtatttgagttttctgcattatcttgggcagatactgaacgagatattagtgcatggctt
ggcaacagattacaaaagacatcatttgataaattaaaatccattagagaacctctggga
agatatattcaaaccaataataaaaatagtaaaaataataactccaatacaacagatacg
gcaacactcgataacgatttatatgacgaaattatggaatatagaatttataaaaatctt
caaacaagtgataacttttattatcaatgtacaaaaggattcaatgatatggatgtccat
gcttatttcagtcatttcgaaactccttatgatgcatttgtggcttatatggatatagta
tatgattttaaaactcacctaacaatttctcagattttggaaatatataaagaaaaatta
aatcgattaaataatgagctaaatgaattaaaagaattaaataaaaaagaaaacgaagat
acctcagaattaaataatatcataaatgatttaaaagataagattaaaaacatggagctc
caattaaacttaaaagatgaaaatattcaaaagttaaaagaggaaggtgtaaatttagtc
aataaattaaaacaatacgaaaaagaaataatctcaaaaactgagaatgtaaaaaaagaa
ataatgaatttaaaaaaagagcacgagcaagaaattaaaaaaaaagaaaataaactagga
aataactcatataatataagaaataatgatatacaaaaagataacaataaaaataataaa
aataataaaaataatagcaataataagaataataagaatagtgattttattataggctct
taa

DBGET integrated database retrieval system