KEGG   Magnetospirillum magneticum: amb3961Help
Entry
amb3961           CDS       T00305                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzyme
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mag  Magnetospirillum magneticum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amb3961
  Amino acid metabolism
   00310 Lysine degradation
    amb3961
   00380 Tryptophan metabolism
    amb3961
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     amb3961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4369456..4372041
Genome map
AA seq 861 aa AA seqDB search
MAQLDPLGLSKPEQHPELDYRTYGFTDADLDREIFIDHVLGLESASLRTIVRIVQETYCA
RIGVEFMHIQDPDQKAWIQKRIESIHNRTDFTARGKTAILERLTEAEGFERFLQMKYTGT
KRFGLEGGESVIPALEQILKRGSQLGVDEVVMGMAHRGRLNVLANFMKKPYQAIFSEFQG
NAANPEDVQGSGDVKYHLGTSADRDFDGKTVHLSLMPNPSHLEVVGPLVVGKVRAKQTQF
GDTERKRVMGIILHGDAAFAGQGVVPETMLLSQLKGYATGGTMHIIINNQIGFTTAPQYS
RSGPHSSDVAKGFQAPVFHVNGDDPEAVVHVARIATEYRQEFGADVVIDMVCYRRHGHNE
SDEPAFTQPQMYRKIASHPTTRAIYMEKLVAEGTLSRYDADAIFANFQARLEQDYEAAKS
FKVNKADWLEGKWQGLAQLAEEEEFREEKTGVAADILKEVGHALARTPEGFNVNKKIVRQ
LQAKKEMMDKGEGIDWATAEALAFGTLLIEGNGVRLSGQDCGRGTFSQRHCRLTDQETED
RVEPLNHIRPGNQAYFEVMDSPLSEEAVLGFEYGYSQAEPNTLTLWEGQFGDFANGAQVI
IDQFINSGESKWLRMSGLVMLLPHGYEGQGPEHSSARWERYLQLSGEDNWQVCNITTPAN
YFHALRRQLRRNFRKPLIIMTPKSLLRHKLCVSKLDDLVTGSRFRRVLPETETLVADAKI
RRVLLCSGKVYYDLLEERTKRGLKDVAIIRVEQLYPWPKDTIKAQLARYPNAELLWVQEE
PANMGPWTFVDRRIEFICEELDIKAKKALYCGRRAAASPATGLYKTHVAEQEWITGMALT
GELVTLPQPFRRASKLSRLTA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctggacccgctgggcctgtccaagcccgagcagcatcccgagctggattac
cgcacctacggcttcaccgatgccgatctcgaccgcgagatcttcatcgaccatgtgctg
gggctggaaagcgcctcgctgcggaccatcgtgcgcatcgtgcaggagacctattgcgcc
aggatcggcgtggagttcatgcacatccaggaccccgatcagaaggcctggattcagaag
cgcatcgagtccatccacaaccgcaccgactttaccgcgcgcggcaagaccgccatcctg
gagcgcctgaccgaggccgagggcttcgagcgcttcctgcagatgaagtacaccggcacc
aagcgcttcggccttgagggcggcgaaagcgtcattccggcgctggagcagatcctcaag
cgcggctcgcagctgggcgtcgacgaggtggtgatgggcatggcccaccgcggccgtctc
aacgtcctggccaatttcatgaagaagccctaccaggccatcttctccgagttccagggc
aacgccgccaacccggaagacgttcagggctcgggcgacgtgaagtaccacctgggcacc
tcggccgaccgggatttcgacggcaagaccgtccacctgtcgctgatgcccaacccctcg
cacctggaagtggtcggccccctggtggtcggcaaggtgcgcgccaagcagacccagttc
ggcgacaccgagcgcaagcgggtgatgggcatcatcctgcacggcgacgccgccttcgcg
ggtcagggcgtggtgccggagaccatgctgctgtcgcagctcaagggctatgccaccggc
ggcaccatgcacatcatcatcaacaaccagatcggcttcaccacggcgccgcagtattcg
cgctccggtccccattcgtcggacgtggccaagggcttccaggctccggtgttccacgtc
aacggcgatgaccccgaagccgtggtgcacgtggcccgcatcgccaccgaataccgccag
gaattcggcgccgacgtggtgatcgacatggtctgctatcgccgtcacggccacaacgag
tcggacgaaccggccttcacccagccgcagatgtaccgcaagatcgcctcccaccccacc
acgcgggccatttacatggagaagctggtggccgaggggacgctgtcgcgctatgacgcc
gacgccatcttcgccaacttccaggcccgcctcgagcaggactacgaagcggccaagagc
ttcaaggtcaacaaggccgactggctggaaggcaagtggcagggcctggcccagctggcc
gaggaagaagagttccgcgaggagaagaccggcgtggccgccgatatcctcaaggaagtc
gggcacgcgctggcacgcacccccgagggcttcaacgtcaacaagaagatcgtccgccag
ctccaggccaagaaggagatgatggacaagggcgagggcatcgactgggccaccgccgag
gccctggccttcggcaccctgctgatcgagggcaacggtgtccgcctgtcgggccaggat
tgcggacgcggcaccttctcgcagcgtcactgccgcctgaccgaccaggagaccgaggac
cgcgtcgagcccctcaaccacatccgccccggcaaccaggcctatttcgaggtcatggac
tcgccgctgtcggaagaggcggtgctgggcttcgaatacggctattcccaggccgagccc
aacacgctgaccctgtgggaaggccagttcggcgatttcgccaacggcgcccaggtgatc
atcgaccagttcatcaactcgggcgagtccaagtggctgcgcatgtcgggtctggtgatg
ctgctgccccacggctatgagggccaggggccggagcactcctccgcccgctgggagcgc
tatctccagctctcgggcgaggacaactggcaggtctgcaacatcaccacgccggccaac
tacttccacgcgctgcggcgtcagctgcgccgcaacttccgcaagccgctgatcatcatg
acgccgaagagccttctgcgtcacaagctgtgcgtctccaagctggacgatctggtcacc
ggctcgcgcttccgccgcgtgctgcccgagaccgagaccctggtggccgatgccaagatc
cgccgcgtgctgctgtgctcgggcaaggtctattacgacctgctggaagagcgcaccaag
cgcggcctcaaggacgtggccatcatccgcgtcgagcagctttatccctggcccaaggac
accatcaaggcccagctggcccgctatcccaacgccgagttgctgtgggtgcaggaagag
ccggccaatatgggtccgtggaccttcgtcgaccgccgtatcgagttcatctgcgaggaa
ctggatatcaaggcgaagaaggccctgtattgcggtcgccgcgccgccgcgtcgcccgcc
accggcctgtacaagacccacgtggccgaacaggaatggattaccggcatggcgctgacc
ggcgagctggtcaccctgccccagccgttccgccgcgcttccaagctctcccgtctgacc
gcctag

DBGET integrated database retrieval system