KEGG   Magnetospira sp. QH-2: MGMAQ_1002Help
Entry
MGMAQ_1002        CDS       T03795                                 

Definition
(GenBank) putative non ribosomal peptide synthase
Organism
magq  Magnetospira sp. QH-2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
999356..1005313
Genome map
AA seq 1985 aa AA seqDB search
MTLNSRQDLEAQTLVEVLRRRAESHPDRRSLIFLADGEEESETLDYGRLDERARAVAALL
RSHHTAGDRVLLLIPPSLDFVAAFLGCLYAGAVAVPSPAPMSSRALMRIESMIEDCRPSV
VLTNHEVMEKTGEARTGNPLLSQPDWLCIEDAGHPEEAPITRVTGGDLAFLQYTSGSTSA
PKGVEVTHGNLMANMRMIEEGTGHAEDTPMLSWLPMYHDMGLIGCLLQPLYLGTQSVLMP
PIRFIQKPIRWLRAVSKYRPHTSGGPNFAYDLCVDRTTPEERQGLDLSSWRVAFNGAEPV
RAGTLESFAHTFAEYGFRAEGHYPNYGLAEGTLIVGGGRKNELPVVRPYDTEALEQHRAE
PVKADAPTAGLLVSSGRTIQDQRIAIVDPQTGRCLEDRKVGEIWVSGDNVARGYWGRPEE
TEATFGAHLADEPDAGVFLRTGDLGFLDDQELFVTGRSKDLIIIHGRNIYPQDVELMAER
SHPALAAAGGAAFALDREGEERLILVHELTRQYRKFDLAEVAAAARAAVLAEFEVPIAAL
YLIKPGRAPKTSSGKIMRHRVKQNLMEDVLDEVWADIPSAPQDPMTQSAWNDAHRPDDVL
GLLCVEMGAALGILPETVDTGCPVQAFGLDSLAAAGLAHRIEERLGFDVPLTTFMQDRSL
SDLAPELTAERERRHRAGGWPEPPAAPSEPHAEAAWLPMTRGQKALWFQQHLMPDSSAYN
VNLTIELRGSLDRDALRRTLAHLVQCHQVLRLCPTRHHGEPAWHPFSPAPDAAPLGLTEI
GADGLTDEEVLRLVIDEAHQPFPMDGPPLARAVLYRHGHRHLLLICLHHLICDGWSMNVL
YDDLRRFYAAARTGSPLPTPSGRPYVDHLRSQEGRLAGEPGTRDLSYWRRHLADLPPMLT
LPVARPRPPVQTFLGGSVPLVVPKALSDDLRVSAKAAGVTPFVLLLAAFQILLGRYSRNR
TFALGTISSGRTRPGFEETVGYFANPLVLKADIDDQLSFTQFAQGVRDVLLEALEHQELP
FSALVEQINPVRDPSAAPLFQIAFGLTDIGGETGKNQEDLTFTPLILDQQEGQFDLNLEF
FRTDDELKGTFNYADGLFDSATVTHMAQHYLQLVADAIERPDTPVRLLDMTPGPARVELE
NWSLSAPPTAAGDHSELIHDLIAKVAAKTPEAPAVRRTDSDDADLLTYGELDRRAGCLAT
LLRQRGVGRDVPVGIFLKRSPEMVVAVLATLKAGGAYLPLDPSYPREHLATLIEDGAPRV
ILADDSLLSRLPDNIHSLAVVLPLSQFPLEGDPQPLEEQADPESLAYVIFTSGSTGRPKG
VMLPHRAAVHRLNWKVQALGIGPEDRLLQSIPLSFDPSVWELFAPLIAGAQVVLPRAGIQ
QDPAEMVAVMAHHGISLISCVPSLLAHLTDQPGLADCHALRHVICGGEPLTGELADRFGS
RSKARLHHFYGPTEATIYATHWLCRNGDSGRLPIGRPVAGAHCHVVDENLHSQPVGVPGE
LVIGGAGLARGYMRRPDLTERAFVSDPLSDIPQARLYRTGDLAMWRPDGTLQFLERLDNQ
IKVRGFRVEPGAIEGKLRDHPAVAEAVVTLHTPGGSEGSLVAYVVSPGLEGLPSGLRGFL
TDRLPAYMVPTYLISLEALPLLPSGKVDLAALPEPTGTESSQRAPYAAPSTNMEAALVRI
WEEVLHQPRIGVRDNFLELGGHSLMALRLVTRIQEDMGLRISPMAVMQTPTIEALALELQ
KAEERAHGYLVQVQNGHRGIPVFYVAPGHGDLVSFSVLARRIDPSRPFYALVPPRRPGET
LQLDIGELAERYVEEMRTRHPDGPYLIAGFSLGGVVALEVARLLRAEGRTVAPVILLDTF
FPYLPGLSHSIFKMVRALALAVGKPAEKWFHRPLQQIFTDQGLTAQVEAMRRFKPQPYPG
PVVLIMSTTAKRLRALLFRPWRRLLVDLRSTEPVTGWHDQMFQDPHIIELARIIEPHLTP
PEKKS
NT seq 5958 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaactcccggcaagacctcgaggcccagaccctcgttgaagtcctaagacgc
cgggcagagtcccacccggatcgccgttccttgatcttcctggctgatggcgaggaagaa
tccgaaaccctcgattacgggcggctggatgaacgggcgcgggcggtggcggcccttttg
cgcagccatcatacggcgggcgaccgggtcctgctgctcattccgccgagcctggatttc
gttgcggcctttctcggatgtctctatgccggcgccgtggccgtgccctctccggcgccc
atgtccagccgcgcgctgatgcgcatcgaatccatgatcgaggattgccgcccaagcgtg
gtgctgaccaaccacgaagtgatggagaaaaccggcgaggcacggaccggcaatccccta
ttgtctcagcctgactggctctgcatcgaagatgccggtcatccggaagaggccccgatc
acccgggtcaccggcggcgacctggcctttcttcaatatacgtctggatccacctcggcg
ccaaagggtgtggaagtcactcatggcaacctgatggccaacatgcggatgatcgaggaa
ggcaccggccacgccgaggacacccccatgctttcctggttgcccatgtatcacgacatg
ggcctgatcggctgcctgttgcaacctttgtacctgggcacccaatcggttttgatgcca
ccgatccggtttatccaaaaacccatacgctggctgcgagcggtctccaaataccgcccc
cataccagcggcggccccaatttcgcctatgatctctgcgttgaccgcaccacgccggaa
gaacgacaggggttggacctgagcagttggcgggtagcattcaacggcgcggagcccgtg
cgggcgggaaccttggaatcctttgcccatacctttgccgaatacggcttccgcgccgaa
ggccactatcccaactacggactggccgaaggcacgttgatcgttggcggtggtcgcaag
aacgaattgcccgtcgtccgcccctatgacacggaagcgctggagcaacatcgcgcggaa
ccggtcaaggccgatgctccaacagccgggctcctggtcagcagcggtcgcaccatccaa
gatcagcgcatcgccatcgtcgatccgcaaaccggccgttgtctggaagaccggaaggtg
ggcgagatctgggtttccggcgacaacgtggcacggggctattgggggcgcccggaagag
accgaggccacattcggggcccatttagccgatgagccggatgccggggtgttcctgcgt
accggggacctgggattcctcgatgatcaagaactgttcgtcaccggacgcagcaaggat
ctgatcatcatccatggccgcaatatctatccgcaagacgtggaactgatggccgaacgt
agccatcccgccctagccgccgccggcggggccgcctttgccctggaccgggagggcgag
gaacgactgatcttggttcacgaattgacccgccagtaccgcaagtttgatctggccgaa
gtggccgcggccgcccgggccgccgtgctggcggaatttgaagtccccattgccgccctc
tatttgatcaagccggggcgggcccccaaaacatccagcggcaaaatcatgcgccaccgg
gtcaagcaaaacctgatggaagatgtcttggacgaggtttgggccgatatcccgtcggcc
ccgcaggatccaatgacgcaatccgcctggaacgacgcgcatcgccccgacgatgtcttg
ggcctgctctgcgtggaaatgggtgccgccctgggtattctgccggaaactgtcgatacc
ggctgtccggttcaggccttcggtctggattccctggccgccgccggattggctcatcgg
atcgaggaacgcctcggcttcgatgtaccgctgaccaccttcatgcaggatcgtagtctc
agcgatttggcccccgaattgaccgccgagcgcgagcggcgccacagggccggtggatgg
ccggagcctcccgcggcgccaagcgaaccccatgccgaagcggcgtggctgcccatgacc
cggggtcaaaaggccctttggttccagcaacatttgatgcccgatagcagtgcctataat
gtcaacctgaccatcgaattgcggggatccctggatcgggatgcgctgcgacggaccctt
gctcatttggtccaatgccatcaagtgctgagactatgcccgacccgccatcacggcgaa
ccggcgtggcaccccttcagtcctgcccccgatgccgctccccttggactaacggagatc
ggcgcggacggattgaccgacgaagaggtcctgcgcctggtcatcgatgaggctcatcag
cctttccccatggacggtccccccctggcccgcgcggtcctgtatcgccacggccaccgc
catctgctgctgatctgtctgcatcatctgatatgcgacggctggtccatgaatgtgctg
tacgacgatctgcgccgtttctatgccgccgcacgcaccggatccccgttgcctactccc
tccgggcgtccctatgtggatcatctgcgcagccaggagggccggttggccggtgaaccg
ggcacccgggatcttagctattggcgtcgccatcttgccgatttgccgcccatgctgact
ttgcccgtggcccgcccccggccaccggtgcagaccttcctcggaggatctgttccactt
gtcgttcccaaggccttgagcgatgatttgcgcgtgtcagccaaggcagcgggtgttacc
ccctttgtcctgctgctggccgctttccagatcctgcttgggcgctatagccgcaaccgg
acctttgcgttgggcaccatcagttccgggcggactcggcccgggttcgaggaaaccgtg
ggctatttcgctaatccgctggtactcaaggcggatatcgatgaccagctttcctttacc
caatttgctcaaggggtgcgcgatgttctgctggaggcccttgagcatcaggaactaccc
ttttcggccttggtggaacagatcaatccggttcgtgatcccagcgccgcaccattattt
cagattgcctttggcctgaccgacatcggcggagagaccgggaagaatcaagaagatctg
accttcacacccttgattctcgatcagcaggaaggacagttcgacctcaatttggaattc
ttccgtaccgacgacgaactaaaaggaacgttcaattatgccgatggcctgtttgattcg
gccacggttacccacatggcccagcattacctgcaactggtcgccgatgccattgaacgc
cccgatacaccggtacgccttctggatatgacccctggtccggcccgagtcgaattggag
aactggtcgctgagtgctccccccaccgccgccggggatcattccgagctgatccatgac
ttgatcgccaaggtggcggccaagaccccggaggcgccggcagtgcgtcggacagactca
gacgacgccgatctcttgacctatggcgagttggaccgccgggccggatgtctggccact
ttgttgcgtcaacgcggggtgggacgggatgtgcccgtcggcatcttcctcaagcgttcc
ccggaaatggtcgtggcggtgctggcgactttgaaagctggcggagcctatctccccctt
gatccttcctatcctcgggaacatttggcgacgctgatcgaagacggggcccccagggtc
atcctggccgacgattccttgctgtcccggctgcctgacaatatccatagccttgccgtt
gtcctgcctctatcccagtttccccttgaaggagaccctcagccactggaagaacaggcg
gacccggagtccctggcatacgtgatcttcacttccggctctaccggacgaccgaagggc
gtgatgctgccccatcgtgccgccgtccaccggctgaattggaaagtccaggccctgggc
atcgggcccgaggaccggctgttgcagtccatccccttgagcttcgacccatcggtctgg
gagttattcgcccccttgatcgccggagcccaggtggtcctgccccgtgctggtattcag
caagacccggcagagatggtcgccgtcatggcgcatcacgggatatcccttatttcctgt
gtgccatctttgctcgctcatttgacggatcagccgggactggccgattgccacgccttg
cgccacgtcatctgcggcggcgaacctttgaccggtgagctggccgatcgcttcgggtcg
cgcagcaaagcccgcctgcatcatttttatggtcccacggaagcaaccatctatgccacc
cattggctctgccggaacggtgattccgggcggctgcccatcggcagaccggttgccggc
gcccattgtcatgtggtcgatgaaaacttgcactctcagcccgtgggcgtaccgggcgaa
ctggtgatcggcggggcgggtttggcccggggctatatgcgcagaccggatctcaccgaa
cgcgcattcgtgtccgatcccttgtccgatataccgcaggctcggctttatcgcaccggt
gatctggccatgtggcgcccggacggaaccctgcaattcctcgaaaggctggacaatcag
atcaaggtccgcggcttccgggtcgagccgggcgccatcgaaggcaaactgcgcgaccac
ccggcagtggccgaagcggtggtcaccctccatacacccggcgggagcgaaggcagtttg
gtggcttacgtggtttctccgggcctggagggcctgccatctggactgcgtggatttttg
accgatcgattgcccgcctatatggtccccacctatctgatttccctggaggctctgccg
ttgctccccagcggcaaggtcgacttggcggcgctacccgaaccaacgggtacggagagc
agccaaagagccccctacgcggcacccagcacaaacatggaagcagccttggtgcgcatt
tgggaagaggttcttcatcaaccgcgcatcggtgttcgcgacaactttctcgaactgggc
gggcactcactgatggcccttcggttggtgacgcgcatccaggaagacatgggcctgcgg
atctcgcccatggccgtcatgcaaacaccgaccatcgaggccttggcccttgagctgcag
aaggccgaggagcgggcgcacggctatctggtacaagttcaaaacggccatcgcggcatc
cccgtgttttacgtggcgccgggacacggggatctggtcagcttcagcgtgttggcccgc
cgcattgacccctcccgtccgttctatgccttggttccgccgcgccgaccgggggaaacc
ttgcagctggatatcggtgaactcgcggaacggtacgtggaggaaatgcgaacccgccat
cccgatggtccctatctgattgcaggattctcccttggtggcgtggtcgccctcgaagta
gcccgattgctgcgcgccgagggccggaccgtggcgccggtgattttgctcgacaccttt
ttcccctacctgcccggccttagccattccattttcaagatggtgcgagccttggcgctg
gcggtcggcaaaccggccgaaaagtggttccatcgcccgctgcaacagatcttcaccgat
cagggcctgaccgcccaagtcgaggccatgcgccggttcaagccacagccctatcctggt
ccggtggtgttgatcatgtcgaccaccgcaaagcggctacgggccctcctgttccgtccg
tggcggaggctactcgttgatcttcgctccacggagccggttactggctggcatgaccaa
atgttccaagatcctcatatcattgaattggcccgaatcatcgagcctcacctgacgccg
ccggaaaagaagtcctaa

DBGET integrated database retrieval system