KEGG   Magnetospira sp. QH-2: MGMAQ_3624Help
Entry
MGMAQ_3624        CDS       T03795                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
magq  Magnetospira sp. QH-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:magq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGMAQ_3624 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    MGMAQ_3624 (sucA)
   00380 Tryptophan metabolism
    MGMAQ_3624 (sucA)
Enzymes [BR:magq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MGMAQ_3624 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3708540..3711464
Genome map
AA seq 974 aa AA seqDB search
MTPTLDTLLSGSNATYIAELYGKYLENPGSVDATWAGFFTELEEDGRAVLDELRGATWAP
SGTTVIGGPGGARPTAAGPGLASGPSTSDLKRATHDSIRALMMIRTYRVRGHLIANFDPL
GLEGKSYHPELDYKYYGFNEEDLDRPIFIDFQLGRETATLKEILGVLKATYCDTIGVEFM
HMQDPEEKAWIRQRIEDLPTRHNFTHLGKRTIFQRLIEAEGFERFLDKKWKGTKRFGLDG
GESLIAALEQIVKRGSQLGVDDIVIGMPHRGRLNVLASVMCKPYRAIFAEFHGVASDAFS
DVQGSGDVKYHLGVSADRVFDGTRVHLSLTANPSHLEAVNPVVVGKVRSKQNRRGDKKRQ
NVMGILMHGDAAFAGQGLVAETLEMSQLEGYTTGGTIHFIVNNQIGFTTVPSKSRSSPYC
SDVAKSIQAPIFHVNGDDPEAVVHVARLAIEFRQEFKRDVVIDMFCYRRHGHNEGDEPMF
TQPIMYRTIAKHQRTLEVYRDRLIREGVLTQQDAETMINEFEARLEADFETATTYRPNKA
DWLEGVWDGLIRLNEEEELREDDTSVPMELLKTVGNAISRKPDNFNLHPKIARQLDAKAK
AVDQGKGIDWATAEALAFGTLMTEGTSVRLSGQDCGRGTFSHRHSVLIDQVSEEKYLPLQ
NICEGQGNYEVLDSPLSEFGVLGYEYGYSLDDPHTLVLWEAQFGDFANGAQVMIDQFISS
GESKWMRFCGLVMLLPHGMEGQGPEHSSARLERYLQLCAEDNLQVCNITTPANYYHALRR
QVRRNYRKPLVIMSPKSLLRHKQVISDLKDMAEGTKFRRVLPEVDKLAKNDKIRRVVLCS
GKVYYDLLQTRRDEGLDDVAIVRVEQLYPWPRKGVMAQLARYPKAEVVWCQEEPANMGSW
TFVLPRLAHILQSLGLSQTLPFYAGRCAAASPATGFAKVHAAEQAQLVNEALNIAPDDLP
QPFRPPAKPSDRRC
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacgcttgatacgctgctcagcggatccaacgccacctatatcgccgaactc
tacggcaaatatctggaaaacccggggtccgtggatgccacctgggccggattcttcacc
gagttggaagaagacggccgagcggtgttggacgaactgcgcggtgccacctgggccccg
tcgggaacgacggtcatcggcggaccggggggtgcccgtcccaccgccgccggtccgggt
ctggcctctggtccgtcgacttccgatctcaagcgggccacccacgattccatccgcgcc
ttgatgatgatccgtacctaccgggtgcgcggccatctgatcgccaatttcgatcccctg
gggctggagggcaagagctaccatccggagctcgactataaatactacggtttcaacgaa
gaagacctggaccggccgattttcatcgacttccagctcggacgtgaaaccgccacgctg
aaggaaatcctgggtgtcctcaaggccacctattgcgacaccatcggcgtcgagttcatg
catatgcaggaccccgaggaaaaggcctggatccgccaacgcatcgaagatctgccgacg
cgccacaacttcactcatctgggtaagcggaccattttccaacggctgatcgaggccgag
ggcttcgaacgtttcctggacaagaaatggaaaggcaccaagcgcttcggcctggacggc
ggagaatccctgattgccgccttggaacagatcgtcaagcgcggctcgcagctgggcgtg
gacgacatcgtcatcggcatgccccatcggggacggctgaatgttctagcctcggtgatg
tgcaagccctatcgcgccattttcgccgagttccatggggttgcctctgacgccttctcc
gatgtgcagggctccggcgacgtgaagtatcacctgggcgtgtccgccgatcgggttttt
gacggaacccgcgtgcatctgtcgttaaccgccaacccgtcccacctggaagcggtgaat
ccggtggtggtgggcaaggtgcgctcgaagcaaaaccgccgcggcgacaaaaagcgtcaa
aacgtcatgggcattttgatgcatggcgacgcggccttcgccgggcagggcctggtggcc
gaaaccctggagatgagccagctggaaggctataccaccggcggcaccatccatttcatc
gtcaataatcagattggctttaccacggtaccgtccaagagccggtcatccccctattgc
tcggatgtggccaagtccattcaggcaccgatcttccacgtcaacggcgacgatccggag
gccgtggttcatgtggcccggctggccatcgagttccgccaggaattcaagcgcgacgtg
gtcatcgacatgttctgttaccggcgccacgggcataacgagggcgacgagcccatgttt
acccagccgatcatgtaccgcaccatcgccaagcatcagcgcactttggaagtctaccgg
gaccggctgatccgcgaaggggtgctgacacagcaagacgccgagaccatgatcaatgag
tttgaagcccggctggaggccgacttcgaaaccgccaccacctatcgccccaacaaggcc
gattggctcgaaggggtatgggacgggctgatccggctcaacgaggaagaggaactgcgc
gaggacgatacctcggttcccatggagctgttgaagaccgtcggcaacgccatttcccgc
aagcccgacaatttcaacctgcacccgaaaatcgcccgccagttggacgccaaggccaag
gccgtggaccaaggcaagggaatcgactgggccaccgccgaggccctggctttcggcacg
ctgatgaccgagggcacctcggtgcggctgtctggccaggactgcgggcgcggtaccttc
tcccatcgccattcggtactcatcgatcaggtgagcgaggagaaatatctgcctttgcaa
aatatctgcgaaggtcagggcaattacgaagtgcttgacagcccgctctctgagttcggc
gtgcttggctatgagtatggctattccctggacgatccccataccctggtgctctgggaa
gcccagttcggcgacttcgccaacggggcccaggtgatgatcgatcagtttatcagttcg
ggtgaatccaaatggatgcgcttctgcggcttggtcatgctgctgccccatggcatggaa
ggccaaggtccggaacactcctcggcccgcctggaacgctatctgcaactctgcgccgag
gacaatttgcaggtctgcaacatcaccactccggccaactactatcatgccctgcgccgc
caggttcggcggaactatcgcaagccattagttatcatgtccccgaaatcattgctgcgt
cacaagcaggtgatatcggacctcaaggacatggccgagggcaccaagttccggcgggtg
ttgccggaagtggataagctggccaaaaacgacaagatacgccgggtcgtgctctgtagc
ggcaaagtctactatgatctgctgcagacgcgccgggacgaaggtctcgacgatgtggcc
attgtccgggtggaacagctctatccctggccacgcaagggcgtcatggcacaattggcg
cgctaccccaaggccgaggtggtctggtgccaagaagaaccggccaacatgggctcttgg
acctttgtgttgccccggctggcccatattcttcagagcctgggactcagccagacactg
cccttttacgccgggcgatgcgccgcggcgtcccccgccaccggctttgccaaggtccat
gcggcggaacaggcgcaactggtcaacgaggcattgaacattgcccccgatgacctgccg
caacccttccggcctccagccaaaccatccgaccgcagatgctga

DBGET integrated database retrieval system