KEGG   Magnetospirillum sp. XM-1: XM1_2072Help
Entry
XM1_2072          CDS       T04231                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor EF-Tu, possible GTP-binding factor (duplicate of tufA)
  KO
K02358  
elongation factor Tu
Organism
magx  Magnetospirillum sp. XM-1
Brite
Translation factors [BR:magx03012]
 Eukaryotic Type
  Elongation factors
   XM1_2072 (tufB)
 Prokaryotic Type
   XM1_2072 (tufB)
Mitochondrial biogenesis [BR:magx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    XM1_2072 (tufB)
Exosome [BR:magx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XM1_2072 (tufB)
  Exosomal proteins of breast cancer cells
   XM1_2072 (tufB)
  Exosomal proteins of colorectal cancer cells
   XM1_2072 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:2083363..2084553
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETSNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKCDMVDDPELLDLVELEVRELLSSYDFPGDDIPIVKGSALCALE
DKQPEIGRDAILKLMAEVDAYIPQPERPKDKPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKATVKTTCTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGS
ITPHTKFEAEAYVLTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVELPEGTEMVMPGDNVK
MHVTLIAPIAMDQGLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctaaattcgagcgcaacaagcctcactgcaacatcgggaccatcggtcac
gttgaccatggcaagacctcgctgaccgcggcgatcaccaagatcctggccgagaccggc
ggcgccaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcccgtggc
atcaccatctcgaccgcccacgtcgagtacgagaccagcaaccgccactacgcccacgtg
gactgccccggccacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgccatcctggtggtgtcggccgccgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgcccgccctggtggtgttcatgaacaagtgcgacatg
gtcgacgatcccgagctgctggatctggtcgagctggaagtgcgcgagctgctgagctcg
tatgacttccccggcgacgacattccgatcgtcaagggctcggcgctgtgcgccctggaa
gacaagcagccggagatcggccgcgacgccatcctgaagctgatggccgaagtcgacgcc
tacatcccgcagccggagcgtcccaaggacaagccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgcgtcgagcgtggcgtggtgaag
gttggcgaggaagtcgagatcgtcggcatcaaggcgaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctcgatcagggggaggccggcgacaacatcggcgccctg
ctgcgcggcaccaagcgcgaggacgtggagcgcggccaggttctggcggctccgggttcc
atcacgccccacaccaagttcgaggccgaggcctacgttctgaccaaggaagagggcggc
cgtcacactccgttcttcaccaactatcgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtcgagctgccggaaggcaccgagatggtgatgccgggcgacaacgtgaag
atgcacgtgaccctgatcgccccgatcgccatggaccagggcctgcgcttcgccatccgc
gaaggcggccgtaccgtcggcgccggcgtggttgccaagatcgtcgagtaa

DBGET integrated database retrieval system