KEGG   Metarhizium robertsii: MAA_00003Help
Entry
MAA_00003         CDS       T03107                                 

Definition
(RefSeq) Cytochrome P450 CYP6004A3
Organism
maj  Metarhizium robertsii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1064 aa AA seqDB search
MPAKIQTLMSAIRRKPERAPDGKSDQEAAGEVKMKRTSISHDLTHLKPKQATTVAHAITT
LASGKPLDDKDLLLEKGVSMLQTLPPNSGLSSTISDGFITMLWNDLPHPATTTAGITARY
RQHDGSGNNPWIPEMGKAGSPYSRSVPPTKPKGPNLPDPELVFDKLLRRTGPFRPHPSGL
NRMFFSFATIVIHECFQTSRSDQWINETSSYVDLSTLYGNTDKEQKRVRTYENGKIFADS
MASDRIMMMPPGVIALLVMFSRNHNKIAEDLLSINEDGKYKPWDSLGEQEKKWQDEDVFQ
LSRNINVGFFASIVLKDYVAAILNTPRANSTWSLDLGAEIKKSGRRMERGIGNAVSVEFA
VLYHWHAALSSADAKWMENMLRLHLPELKSLDDITVEMFTKVAMAAEHNLMTTPAKEWTF
GGLQRGPDGKFSDVDLAEILKDCIEEPAHAFGAHGTPESLKVVDIMGQLQARNVFNVCTM
NEFRRFLNLKPYEDFEDWNPDKETARAAELLYGHIDNLELYPGLMAEVTKPSMPGSGVCP
GHTTGRGILDDAVALVRGDRFLSYDFNSTTLTNWGFSKLRTLPAGAYGGMMPHLLFNGLP
GAWTGTSAYALLPFYTPMAAKEILTHNKIAEQYDMQRPASGRDIIGIHTHQGCKKVFEDR
ENFKVMYQEAIRECTDGHDFMIGWDDAERHSPRSKLLHAVFFEESFEQNVANFFRTHAAK
QIAEHSVTYSSSKRRSIDIVRDVTNVVPILWLANRFAIPLKSKDHPHGLLTIPQTFMAYL
VLFMYQSFNIIPENEWALREGATSAAQTLRTVFDAHLKTTRGVRERVVDWLAKNSAFEVS
PDAHRLYHALNESKLPIGDLVGDCIGMGAPVAGNITQQASLLIDLFLSKGYEEYKARIVE
LAHKDDEASEKELQGFVFEGMRHAGVVPGLPRVAARDVTVEDGARGPVDIQSGNTVLVAT
SNAAMDPVAFPNPEKLDPHRSFEDYTLLGHGLHYCFGSRMVGASLAATLREVFKLKNLRR
APGKQGHFTVVRHTLAGVTMRKYLDSNAKESPIPSSLTLDYDAE
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctaaaattcagacattaatgagcgcgattaggcgaaagcctgaaagagcccca
gatggaaaatcagaccaggaagctgccggagaggtcaaaatgaaaagaacctcgatcagt
catgacctcacccatctcaaacccaaacaggccacgacagtcgcacatgccatcacaaca
cttgcctcggggaagcctctagacgacaaggaccttctactcgaaaagggagtttcaatg
cttcaaactctgccgcccaacagcggcttgagcagcaccatctcggacgggttcatcacc
atgctgtggaacgacctgcctcatcctgccacaacgacggctggcattacggccagatac
aggcaacatgacggcagcggcaacaatccctggatcccggagatgggcaaagctgggtct
ccctactctcgcagtgttcctccaaccaagcccaagggcccgaatctcccggaccccgag
ttggtctttgacaagctgctgcggagaaccgggccttttcgcccgcacccgtcgggactt
aaccgcatgtttttctcgtttgctaccattgtcattcacgaatgcttccaaacctctcga
agtgaccagtggatcaacgagacgtcgagctatgtggacctgagcacgctgtatggcaat
acggacaaggagcaaaagcgtgtgagaacttatgagaatggaaaaatctttgcggattct
atggcctctgacagaattatgatgatgccgccaggggtaattgccttgttggtcatgttt
tcgagaaatcacaacaagattgccgaggatctgctgtccatcaatgaagacggaaagtat
aagccttgggatagtctcggcgagcaggaaaagaagtggcaagacgaagatgtttttcaa
ctttctagaaacatcaacgtcgggttctttgcgtctatagtcctgaaagactacgtcgca
gctattctcaacactccccgcgccaattcaacctggtcccttgatcttggggccgaaatc
aaaaagtctgggcggcgcatggagcgtggcatcggaaacgccgtgtcggtcgagtttgcc
gtcctgtatcactggcatgccgcgctcagctcggccgacgccaaatggatggagaacatg
ctgagactccatctgcctgagctgaaatcgctcgacgacatcacggtggaaatgtttaca
aaggtcgcaatggcggcggagcacaatctaatgaccacgccagcgaaagaatggacgttt
ggaggcctgcagaggggcccggatgggaaattttcagacgttgatcttgcagagattctc
aaggattgcatcgaagagccggcacacgcctttggagcccatgggacgccagagagcctc
aaggtggtggatatcatgggccagttgcaggccaggaatgtgtttaacgtgtgtactatg
aacgagttccgtcgattcctgaacctgaagccgtacgaggactttgaggattggaatccg
gacaaggaaaccgccagagctgcggagctcttgtacggtcacatcgacaacctcgagctg
tatcccggcttgatggccgaagtgacgaagccctccatgccgggaagtggcgtctgccct
ggacacacgacgggaagaggtattcttgatgatgccgtcgcccttgtgaggggggatcga
ttccttagctacgactttaacagcaccaccttgaccaactggggcttttccaagctgcgt
acacttccggccggagcgtacggcggaatgatgcctcatcttctgttcaatggtcttccg
ggcgcttggactggcacctcggcatacgcactgctcccgttttatactcccatggcggcg
aaggaaatattgacccataacaagattgctgagcagtacgatatgcagcggccggctagc
ggtcgggacattattggcatccatacgcaccaaggctgcaagaaggtgtttgaagataga
gaaaacttcaaagtcatgtatcaagaggcaattcgcgagtgcacagacggacacgacttc
atgattggatgggatgatgccgagcgacacagcccgcgatcaaaattactccacgccgta
tttttcgaggagagcttcgagcaaaatgtcgccaacttcttccgcacccatgccgccaag
caaattgccgagcattcggtgacatactcatcgagtaaaagaaggtctattgacattgtc
cgcgacgtgaccaatgtcgtgcccattctctggctggcgaaccggtttgccattcccctc
aagagcaaagaccatccccatggactgttgacaataccccagaccttcatggcctacctc
gtcctcttcatgtatcagagcttcaacatcatccccgaaaacgagtgggccctgagggag
ggagctacatccgcggcacaaactctccgcaccgtttttgacgcccacctcaagacgacg
cgaggcgtgagggagcgtgtcgtagactggctcgccaagaacagcgcatttgaagtcagt
cccgatgcccaccgactctaccacgccctcaacgagtccaagctgcccattggcgatctg
gtcggcgattgcatcggcatgggcgccccggtcgccggcaacattacccagcaggcctct
ctgctgattgacctgtttctcagcaaaggatacgaagagtacaaggcgcgcattgtcgag
ctcgcccacaaggacgacgaggcgtcggaaaaggaactccaaggctttgtgtttgaaggc
atgagacacgccggcgtcgttccgggcctaccgcgcgttgcggccagggatgtcacagtc
gaagacggcgcccgcgggccggtcgatatccagagcgggaatacggttctcgtcgcgact
tccaacgccgccatggatcctgtggcctttcccaacccggagaagttggaccctcaccgc
tcctttgaggactatactctgcttggtcacgggctacactattgctttgggtcgagaatg
gtgggggcgtcgcttgccgccacgcttagggaggtgtttaagctgaagaatttgcggaga
gcgccggggaagcaggggcatttcacggtggttcgtcacacgttggctggggttacgatg
aggaagtaccttgattctaatgcgaaggagtctccgataccaagttctcttacgttggat
tacgatgccgagtaa

DBGET integrated database retrieval system