KEGG   Metarhizium robertsii: MAA_00272Help
Entry
MAA_00272         CDS       T03107                                 

Definition
(RefSeq) SET domain protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
maj  Metarhizium robertsii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MAA_00272
Enzymes [BR:maj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MAA_00272
Chromosome [BR:maj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MAA_00272
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    MAA_00272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 325 aa AA seqDB search
MEDAMSRHFFHHGQDGNKDEKENCHWCQLRSFPTHKTAPITIVNEIDSQTLPQNFRFING
VVLGTGVTAADLSFRSGCTCGQDEDCQYSGCLCLADLDQDEASDDADDDHSGLDSATRAS
LSPARKKAYAYHMHGNKAGLLRSKLHTSKLPLYECHQGCACSPDCPNRVVERGRTVPLQI
FRTPDRGWGVRTQESIKKGQFVDRYLGEVITSAEADRRRDASVVYHRKDVYLFALDKFTD
PQSLDARLKGPPLEVDGEFMSGPTRFINHSCDPNMRIFARVGDHADKHIHDLALFAIKDI
QKGEELTFDYVDGASGDFEELEGKL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgccatgagcagacacttcttccaccatggccaagatggcaacaaagatgag
aaggaaaactgtcactggtgccagctgcggtctttcccgacacataaaacggcccccatc
accatagtaaacgaaatagacagccaaactttaccccaaaattttcgcttcatcaatggc
gtcgtacttggcactggcgtcacagcagccgaccttagcttccgaagcggctgcacctgt
ggtcaggacgaagattgccaatactcaggctgtctatgtctcgcagatcttgaccaagac
gaagccagtgacgatgcagatgatgaccacagtggactggattcggccaccagagcgtca
ctatcaccagcacggaagaaggcatatgcctatcacatgcacggaaacaaggccggctta
ttacgatcaaaactccatacgtccaagctgccactctatgaatgtcaccaaggctgtgcc
tgctccccagattgcccaaaccgagtagttgaacgtggtcgcactgtgccgcttcaaatc
tttcgtacaccggatcgtggatggggtgtacggactcaagagtcaattaagaagggccaa
tttgtggaccgttaccttggcgaagtcatcacgtccgccgaagctgatcgacgccgagat
gcctctgtagtttatcacagaaaagatgtatatctctttgccttggataaattcacggac
cctcagtcgttggatgcccgactaaagggccctccactcgaggtagatggggaatttatg
tcgggacctacccgattcattaaccactcctgcgatccaaatatgcgaatttttgctcgt
gttggggaccacgcagacaaacatatacatgacttggccctctttgctataaaggatatt
caaaagggcgaggagctgacatttgattacgtggatggagcgagtggagattttgaagag
ctagaaggcaagctctaa

DBGET integrated database retrieval system