KEGG   Metarhizium robertsii: MAA_04710Help
Entry
MAA_04710         CDS       T03107                                 

Definition
(RefSeq) Glutathione S-transferase/chloride channel
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
maj  Metarhizium robertsii
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MAA_04710
Enzymes [BR:maj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MAA_04710
Transporters [BR:maj02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAA_04710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 221 aa AA seqDB search
MASLKTMTLHSHAGGPNPWKVAIILEELGLPYEHKFLDFKQVKEEPFISLNPNGRVPVLE
DPNTGISLWESGAIIDYLIDTYDTTNKLQYTSTPEKYQTRVWEHFQMSGQGPYFGQLIWF
TRYHPEKLQSAIDRYANEVRRVTGVIDAHLKKQKTEYLVGDKLTYADLMFVPWAVAVSSM
AGDLLDLSGYDAYDAWFAKLKSRPSAAKIIKEREAALAASH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctcaagaccatgaccctccactcccacgcgggcggccccaacccgtggaaa
gtagccatcatcctcgaggagctcggcctcccctacgagcacaagtttctcgacttcaag
caagtcaaagaagagcccttcatctcgctgaaccccaatggccgggttcccgtcctcgag
gaccccaacaccggcatcagtctctgggagtctggcgccataatcgactacctcatcgac
acctatgacaccaccaacaagctccagtacaccagcacgcccgaaaagtaccagacccgc
gtctgggagcacttccaaatgtcgggccagggcccgtactttggccagctcatctggttc
acgcggtaccaccccgaaaagctccagtcggcaatcgaccgctacgccaacgaggttcgc
cgcgtgacgggcgtcatcgacgcccacctgaagaagcaaaagaccgagtatctggtcggc
gacaagctgacatatgccgatctcatgtttgtcccgtgggccgtggcggtttccagcatg
gccggcgaccttttggacctgtcgggctatgacgcctacgacgcctggtttgccaagttg
aagagccggccgtcggcggccaagatcatcaaggagagggaggcggctctcgctgccagc
cattaa

DBGET integrated database retrieval system