KEGG   Metarhizium robertsii: MAA_04846Help
Entry
MAA_04846         CDS       T03107                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
maj  Metarhizium robertsii
Brite
Enzymes [BR:maj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MAA_04846
Chromosome [BR:maj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     MAA_04846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1151 aa AA seqDB search
MSHSIHGSLSPRQGPTSPASNRANDDNSGLTQSLSQLSLTNEPKTLKPLPSPRNSWGTPA
KPPPRRSSSASPHPRTPSRSPSNGPGSRRASHAETPPLLRKASMNSLHSANGVAPGRPLA
RRSSSSHIISTSPANRTPPEEKPPLTARSIASDYFAAELAEYHGATPTLPTDTVVILNDA
VYGHRFSRPRTSRSALSTIVERPERIKAAVLGISTAYVRLGGRHCQGHLPVHPKRNLSDI
NSIPFRIHKTTRQLSLLSSAVTNVHGTKWMEELKLMCGSAESILAMGGKELQRPDISRGP
EHPAPQKLHEGDLYLCEESLNAMQGALGAVCEAVDTVFGSGPRKAFVGVRPPGHHCSASH
PSGFCWVNNVHVGIMHAALQHGLTHAAIIDFDLHHGDGSQAITWQHNARANAANKSHASW
KRTSIGYFSLHDINSYPCEMGDEDKVKNASLCIDSAHGQSIWNIHLQSWKTEQEFWTLYE
STYAILLEKTRKYLKNEAAKLRASNQVPKAAIFFSAGFDASEWESAGMQRHHVNVPTEFY
ARLSQDVVKLTAEEGLAVDGRVISVLEGGYSDRALCSGIMSHLSGLVGGSHEQSPIKTEQ
ESSGLAYEMGQRIGAINLNADPIMKPPASIYDPAWWATNELDLLEEPEEPLPVPKKPRNS
TPPTYSSPTQASTARVADPIKMKNSLSGLSTSYSKVPQRPTSPPPPEVPWHIAAKELCKT
LIPSDRQTDSCTAEDLNAEASRARRDRQSLLLGNQPPTPSGSDRSLSRMSLRERKSRPIG
PIDEEMSEVLPKTRRKPASTPISSPAKAGRSTPRPAGAQSARKSSRRLSVASTNLSPPRE
EPPPVPPIPATAPVPSRTASRPNSRTGRTQSSNKVPVKKTQAVPSRIDPAPKGGRNASRA
STPAKGAKQSTIAADTPTPATGLPLNAVGNDAKSDIDSLTDGVKKIRINLITKAQRDGKQ
KAKPEQSVEPHRQLGQDSSIVKSEKPPTPEGISSIPNAPEQLPTQLAPASGLPEAPPTPS
LSGGISTPVEEMYTSNTSSPTPTPSIPTGSSPDVPHVTIQPASDASDVFIPYQPEGPEPV
TMVQHEHLKWLPPNIQTPSSVTPVHTPLPSATKTKNNLFHYTSGIRFAPRPDAELQGRPG
SVDKPRTGHEQ
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcactcgattcatgggtcgttgtctccacgacagggaccaacatcaccagcatcc
aacagagcaaacgatgacaactcgggtttgacacagtcgctgagccagctttctttgacg
aacgaacccaaaaccctgaagcctcttccaagcccaagaaactcctggggaactcccgct
aagccgccacctcgaagatcgtcatccgcctcacctcatcctcggacgccttctcgcagt
ccttctaatggaccaggctctagaagagcctcccatgctgagacgccgccactacttcga
aaggcttccatgaactctttacattctgcgaatggtgtcgcgcctggaagacctttggcc
aggcgatcgagctcatcgcacatcatctcaacatccccagcaaacaggaccccccctgaa
gagaagccccccctgacagcaagaagcattgctagcgattactttgcggctgaacttgcg
gaataccatggagctactcctacgctaccaacagacactgttgttattctgaacgatgct
gtatacgggcatcgcttctcccgccctcgaacttcccgaagtgcgttaagcaccattgtg
gaacgacccgaacgtatcaaggctgctgttctaggtatatcgacagcatacgtacggttg
ggtggtcgacactgtcagggtcacttgcctgttcatcccaagaggaacctctccgacatt
aacagcattccctttcgcattcacaagaccactagacaactgtcactgctgtcttcagca
gttaccaatgtacatggcaccaagtggatggaggaattgaaactcatgtgcggttcggct
gagtcaatattggctatgggagggaaggagctgcaacggcctgacatttctcgaggacca
gaacatcctgcaccacagaagctccacgaaggcgatttgtacctgtgcgaagagtctctc
aatgccatgcaaggtgctttgggcgcagtgtgcgaggcagtggacacagtctttggctct
ggtcctcgcaaagcgtttgtcggtgtaagaccccctggccaccattgttctgcttctcac
ccttctggcttctgctgggtgaacaatgttcatgtgggcatcatgcatgctgcacttcag
catggtctcactcatgcagccataatcgactttgatcttcatcacggcgacggctctcag
gccattacttggcagcacaatgcccgcgctaatgcggcgaacaagagccacgcctcttgg
aaaagaacgtcaataggctactttagcttgcatgacattaactcttatccttgcgagatg
ggtgatgaagacaaggtcaagaacgcgagtctctgtatcgatagtgcgcatggccagtct
atctggaatatccacctacaatcctggaaaacggaacaagagttctggaccctgtacgaa
agtacatatgctattctgctggaaaagacacgaaagtacttgaaaaatgaggcagccaag
ctgcgtgcctcaaaccaagtccccaaagcggcaatcttcttctctgcgggctttgatgcc
agtgagtgggagagcgcgggaatgcaacgccaccacgtgaatgtgccgactgagttctat
gccagactatcgcaagatgttgtaaaactgacggcagaggagggactggctgtagatggt
cgggtgattagcgtcctcgaaggtggatatagcgatcgcgccctgtgttcaggaatcatg
agccatctgagtggcctagttggtggcagtcacgagcaaagcccaatcaagacggagcag
gaatctagcgggctcgcgtacgagatgggccaaaggatcggagctatcaacttgaacgcg
gatccgataatgaaacctccggcgtcaatctacgatccagcatggtgggcaacgaatgag
ctggacctcctcgaagaacccgaggagcctctaccagtaccaaaaaaaccacgcaactct
actcctccaacctactcatcgccgacccaggcctctactgctagagttgctgaccccatc
aagatgaagaacagtctctctggtttgtctaccagctattcaaaagtacctcagaggcca
acatcacccccacctcctgaagtgccttggcatatagctgcgaaggaactgtgtaagact
ctgataccatcagaccgtcaaacagacagttgtacggcggaggatctcaatgctgaagca
tcacgggcccgaagagatcgtcagtctcttttgctcgggaaccagccaccaacaccatcc
ggatctgatagatcattatcgagaatgtcgttacgcgaacgtaaatcgaggccaatcggt
cctattgacgaggaaatgagcgaagtgctaccgaagacaagaagaaagcccgcgagcaca
ccaatatcatctccagcaaaggctgggagaagtacgcctcggcctgctggagcgcagtcc
gccagaaaatctagccgccgcctgagcgtggcatctacgaatctgtcccctcccagggaa
gaaccacctccggtccctcctatcccagccacggcgcctgttcctagccgaacagccagt
cgacccaactctaggacgggtaggacacaaagcagcaacaaggttcccgtgaagaagacc
caggcagtgccatcccgaatagaccctgcacccaaaggagggcgaaatgcgtcaagggcg
agcactcctgctaaaggagcgaaacagtctacaatcgcggctgacacgccgacgccggct
acgggactaccgctcaatgctgtcggtaacgatgccaagagcgatattgacagtttgacc
gacggtgtcaagaagataagaatcaacttgatcacaaaagcacaaagggacgggaagcag
aaggccaagccggaacaaagcgtggaacctcatcgtcagcttgggcaggattcgagcata
gtgaagtccgagaaaccacccacacctgaaggcatatcctcgataccaaatgctccggag
cagcttccaactcaactggcgccagcttctggtctccctgaagcaccgccaacaccgtca
ctaagtggaggaatttcaactccggtggaggaaatgtacacatctaatacatcgtcgcct
acgccgactccgtctattcccacgggaagctctccggatgtaccgcatgttactattcaa
ccagctagcgacgccagcgatgtctttattccctatcagccagaaggacctgaacctgtc
accatggtgcagcacgagcatctgaagtggcttccgcctaacattcagacgccttcttct
gtaaccccggttcatacacctctgcctagcgcgacgaaaacgaaaaacaacctattccac
tacacctcagggatccgattcgcgccaaggccggatgcagagttacaaggacgacctgga
tctgtggacaaaccacgcacagggcatgaacagtga

DBGET integrated database retrieval system