KEGG   Mycobacterium abscessus subsp. abscessus: LH56_01015Help
Entry
LH56_01015        CDS       T03341                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mak  Mycobacterium abscessus subsp. abscessus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
229506..231152
Genome map
AA seq 548 aa AA seqDB search
MEINAPAMKSGAIDYLGLLRAGLEELDFYDSRRHLYTRAGADLVVDIRIRAAALRERGLR
RGDRVAMTATSDEEYLATLLAVLLLGAVPCAIAPPPTPSRPDSAGVAHLRAALEVLSPAM
VIAQPRVMVAVVHPNVLSYDQLADANPIDWELLSTAHPADVHHIQLTSGSTSAPKAVVLT
HGNVVHNASAIAYGTRASRGRDRVFSWLPFYHDMGFIQVLAALLYGLRVGVMTPMGFLRD
PISWLRHMSHHGSTHTAGPPFAYRAISDAIGRGGPLVDVDLSSLRHAYVGAEPIPYPVVC
DVTARLRLLGMRNDVLVPCYGMAETVLATSIALQPYPPGETAFGRVYGRRSPENGQLVVS
CGRPVDGLRVRVLSSDGEVLADGAVGDIQVSGPSVMRGYLRPDGGVVAPEGGWHSTGDRG
YLDGGELFVVGRRKEMLIVRGRNFPPYDVERQIDQLSGAGGVSVVFTVQDEQRVRESVVA
VVGTRAALCEYEGLRSRVAGGVRAAFGFSLDDVVVVPARVIPRTTSGKRQRLKVREAYLS
GLLSPAGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcaatgcgccggctatgaagtccggcgcgattgattatctcgggctgcttcgt
gcgggactggaagagctcgatttctacgattcgcgacgccatctgtacacacgtgcgggt
gcagatctggttgttgacatccggatccgtgctgcggcgctacgcgagcgtggactgagg
cgcggtgatcgagtcgccatgaccgccaccagcgacgaagaatacctggcgacactgttg
gccgtgctgttgttgggtgcggtgccctgcgcgatcgcgccgccgcccactccctcgagg
ccggactccgcgggagtagcgcatcttcgcgccgcgcttgaggtgttgagccccgctatg
gtcattgcccagccacgtgtcatggtggcggtcgtgcatccaaacgtgttgtcgtacgat
cagcttgcggatgccaatcccattgactgggagctactttcgactgcacacccagcagac
gtgcaccacatacagcttacctcgggctcgacctccgcgccgaaggcagtagtgctgacc
catggcaatgtcgtgcacaacgccagtgcaatcgcctacggcacaagggcatcgcggggc
cgcgatcgggtgttcagctggctgcccttctatcacgatatgggctttatccaggtgttg
gccgcactgctctacggtctccgagtgggggtgatgaccccgatgggatttctgcgcgat
ccgatctcctggctacgacacatgtctcatcacgggtcgactcacaccgcgggtccaccg
ttcgcgtatcgggcgatatcggacgcgatcggtcgcggcggcccgcttgtagatgtggat
ctgtcctccctgcgtcatgcctacgtgggtgccgagcccatcccttacccggtggtgtgt
gacgtcaccgcgcggcttcgtttgttgggtatgcgtaacgacgtgttggtgccgtgctac
ggcatggcggaaacagtgctcgcgacaagcattgcgctgcaaccatatccaccgggagaa
acagcattcggccgggtttacggccggcgtagtccggagaacggtcaattggttgtgtcg
tgtggtcggccggtcgacggcttgcgggtgcgcgtcctttcgtccgatggtgaagtactt
gctgatggagctgtcggcgatattcaggtgagtgggccgtcggtaatgcggggctacttg
cgtcccgacggcggggtagtcgcgcccgagggcggatggcacagcactggtgaccgcggc
tatctcgacggcggtgaactctttgtggtggggcgtcgcaaggagatgctcatcgtgcgg
gggcgcaacttcccgccctacgacgtcgaacggcaaatcgaccagctctctggtgccggt
ggagtttccgttgtgttcacggtgcaggatgaacagcgcgttcgcgagtcggttgtggcc
gtggtaggaacgcgggcggccttatgcgagtacgagggactgcgtagccgtgtggccggt
ggtgtgcgcgcggcgttcgggttttcactggatgacgtcgtcgtggtgccggcacgtgtg
attccccggaccaccagcggaaaacgtcagcgactgaaggtgcgtgaggcgtatctgtcc
gggctgttgtcaccggccggaggctga

DBGET integrated database retrieval system