KEGG   Mycobacteroides abscessus subsp. abscessus: LH56_05500Help
Entry
LH56_05500        CDS       T03341                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mak  Mycobacteroides abscessus subsp. abscessus
Pathway
mak00250  Alanine, aspartate and glutamate metabolism
mak00410  beta-Alanine metabolism
mak00430  Taurine and hypotaurine metabolism
mak00650  Butanoate metabolism
mak01100  Metabolic pathways
mak01110  Biosynthesis of secondary metabolites
mak01120  Microbial metabolism in diverse environments
mak02024  Quorum sensing
Module
mak_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mak00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LH56_05500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH56_05500
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH56_05500
   00430 Taurine and hypotaurine metabolism
    LH56_05500
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LH56_05500
Enzymes [BR:mak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LH56_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIR42060
LinkDB All DBs
Position
1138865..1140247
Genome map
AA seq 460 aa AA seqDB search
MNASAFSPAYTGRLSTAPVPALRLPDEPMDPQAAYRFIHDELMLDGSSRLNLATFVTTWM
DPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADNLSTEDPSSAVGVSTIG
SSEAVMLAGLALKWRWRAKIGGTDGTAWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLP
MAKGRYVITPEQVLEAVDEDTIGVVGILGTTFTGELEPIAAICAALDKLAATPGKPDVPV
HVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSKEHLPEDLV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMRCLSETARWFGDELGKS
EHFEVITDGSAIPVVSFRLKGKRPYTEFDISHSLRAFGWQVPAYTMPEDVTDIAVLRVVV
REGFSGDLARALRDDLNTVLKGLDELKPNGHFDEVQPFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atcaatgcctccgccttcagccccgcgtataccggcaggctgtccacggcacccgtcccg
gcgctgcggctgcccgacgagccgatggatccgcaggccgcctatcggttcatccacgac
gagctgatgctcgacggcagctcgcggctgaacttggcgaccttcgtcacgacgtggatg
gatcccgaggccgaaaagctgatggccgagacattcgacaagaacatgatcgacaaggac
gagtatccggcgacggccgcgatcgagtcgcgatgcgtggccatggtggccgacctgttc
catgccgacaacttgtccacagaggatccgtcctcggcggtgggcgtgtcgaccatcgga
tcgagtgaggcggtcatgctggccgggctggccctcaagtggcgttggcgcgcgaaaatc
ggcggtaccgacggcaccgcctggaagggacgcacacccaacctggtgatgggttccaac
gtgcaggtggtctgggaaaaattctgccggtacttcgacgtcgaaccgcgatacctgccg
atggccaagggccggtatgtgatcactcccgagcaggtgcttgaggcggtcgacgaggac
accatcggcgttgtcgggatcctgggcaccacgttcaccggagagctggagccgatcgcc
gcgatctgcgcggcgctggacaagctcgctgctacacccggcaagcccgatgtgcccgtg
cacgtcgatgccgccagcggtggtttcgtggtgcctttcctacatcccgaactgcactgg
gacttccggctgccgcgggtggtgtcgatcaatgtcagcggacacaagtacgggctgacc
tatcccgggatcggctttgtggtgtggcgcagcaaggagcatctgcccgaagacctggtg
ttccgggtcaactacctgggtggcgacatgccgaccttcaccctgaacttttcccgcccg
ggcaaccaggtggtggggcaatactacaacttcctgcgactgggccgggccggatatgca
caggtgatgcgctgtctgtcggagacggcacgctggttcggcgacgaactcggcaagagt
gaacatttcgaggtgatcaccgacgggtcggcgatcccggtggtgtcattccggctcaaa
ggcaagcggccgtacaccgagttcgacatctcgcattcgttgcgggcatttggctggcag
gtgcctgcgtacaccatgcccgaagacgtcaccgatatcgccgtgctgcgagtggttgtg
cgcgagggcttctcgggagatctggccagagcgctgcgcgatgatctcaacaccgtgctc
aagggactcgacgagctgaaaccgaacggacacttcgacgaggtgcagccgttcgcccat
tag

DBGET integrated database retrieval system