KEGG   Marinovum algicola: MALG_03339Help
Entry
MALG_03339        CDS       T03981                                 

Definition
(GenBank) Glycosyltransferase
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AKO98483
UniProt: A0A0H4LD03
LinkDB All DBs
Position
3398953..3400188
Genome map
AA seq 411 aa AA seqDB search
MTGPLLYLTGEYPRVTDTFIQREVAALRAQGITIMTASIRRTGPEHLVGEEQIAEAAQTF
HVLEAAKHPLRLAAAKLRLLRHPGRFFRAFALAWRTAPGGLRNWLWQMFYFAEAIMLADH
MQRQGVRHLHNHIAKASCTVAMLASELSGIPYSFTLHGPDIFFAPDHWRLDEKIARARFV
ACISEFCRAQAMIFSDRALWDKLHIVHCGIDPARYDPAPRQGPPHLTFVGRLAAVKGVPV
LLEALSFLKGELPGLRVTLIGDGPERARLEQDAADLGLRDVVDFAGYRSQSEVARALKVT
DALVLPSFAEGVPVVLMEAMAAGRPVITTGVAGVSELVEHGKSGFLVPPGDAQRLAQAIR
AVLADPDRRVEMGRAGRTRVVEDFDIGKEAAWLGRLFEVYADGAAHPGKRP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccccctcctctacctcaccggcgaatacccccgcgtcaccgataccttcatc
cagcgcgaggtcgcggcgctcagggcgcagggtatcacgatcatgaccgcctcgatccgc
cgcaccgggccagagcatctggtgggcgaggaacagatcgccgaggcggcgcagaccttt
cacgtgctcgaggcggcgaaacatccgctgcggctcgccgccgccaagctccgcctgttg
cgccatccggggcggttctttcgcgccttcgccctggcctggcgcaccgcgccgggggga
ttgcgcaactggctctggcagatgttctatttcgccgaggccatcatgctggccgatcac
atgcagcgccaaggcgtgcgccatctgcataaccatatcgccaaggcgagctgcaccgtg
gcgatgctggcctcggagctcagcggcatcccctacagctttaccctgcacgggccggat
atcttctttgccccggaccactggcggctcgacgaaaagatcgcccgggcgcgtttcgtg
gcctgcatctccgaattctgccgggcgcaggcgatgatcttttccgaccgcgcgctctgg
gacaagctgcacatcgtgcattgcggcatcgatccggcacgctacgatccggccccgcgc
cagggcccgccgcatctgacctttgtcgggcggctggcggctgtcaaaggcgtgccggtg
ctgctcgaggcgctgagcttcctgaaaggcgagctgcccgggctgcgcgtcaccctgatc
ggcgacgggccggaacgggcgcgactggagcaggacgcggcggatctcggcctgcgcgac
gtggtggactttgccggctatcgcagccagtccgaagtcgcccgggcgctgaaggtgacc
gacgcgctggtgttgccgagcttcgccgagggcgtgccggtggtgctgatggaggcgatg
gcggccggacgaccggtgatcaccaccggcgtcgccggggtctcggaactggtcgagcac
ggcaagagcggctttctcgtgccgcccggcgatgcgcagcggctggcgcaggcaatccgc
gccgttctggccgacccggaccgccgcgtcgaaatgggccgggccgggcgcacccgcgtc
gtcgaggacttcgacatcggcaaggaggcggcctggctcggccggttgttcgaggtctac
gccgacggcgcggcgcatccgggcaagcggccatga

DBGET integrated database retrieval system