KEGG   Mesorhizobium amorphae: A6B35_20885Help
Entry
A6B35_20885       CDS       T04446                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00340  Histidine metabolism
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mamo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    A6B35_20885
Enzymes [BR:mamo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     A6B35_20885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ANT54063
UniProt: G6Y858
LinkDB All DBs
Position
4428487..4428945
Genome map
AA seq 152 aa AA seqDB search
MSALEFPKAPSDKKALEEGTVLSPRFDASGLVTVVVTDAADGMLLMVAHMNAEALALTLE
TGIAHYWSRSRNALWKKGETSGNLQTVVEMRTDCDQDALWLRVKVLGHDATCHTGRRSCF
YRTVGLNDGKVTLVDDGSKPLFDTEQAYRKPL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcactggaattcccgaaagctccgtcagacaagaaagcgctggaggaaggcact
gtcctttcgccgcgcttcgacgccagtggccttgtcactgtcgtcgtcaccgatgctgcc
gacggcatgctgttgatggtcgcgcatatgaatgccgaagcgctggcgctgacgctggaa
accggcatcgcccattactggtcgcgttcgcgcaacgcgctgtggaaaaagggcgagacc
tccggcaatctccagaccgtcgtcgagatgcgcaccgattgcgaccaggatgcattgtgg
ctgcgcgtgaaagtgttgggccacgacgcaacttgtcacaccggccggcgttcctgcttt
tatcggacggtggggttgaacgacggcaaggtgacgcttgtcgacgacggcagcaaaccg
ctgttcgatacggaacaagcgtatcggaagcctttgtga

DBGET integrated database retrieval system