KEGG   Micavibrio aeruginosavorus EPB: A11S_570Help
Entry
A11S_570          CDS       T02517                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00020  Citrate cycle (TCA cycle)
man00310  Lysine degradation
man00380  Tryptophan metabolism
man01100  Metabolic pathways
man01110  Biosynthesis of secondary metabolites
man01120  Microbial metabolism in diverse environments
man01130  Biosynthesis of antibiotics
man01200  Carbon metabolism
Module
man_M00009  Citrate cycle (TCA cycle, Krebs cycle)
man_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A11S_570
  Amino acid metabolism
   00310 Lysine degradation
    A11S_570
   00380 Tryptophan metabolism
    A11S_570
Enzymes [BR:man01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A11S_570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AGH97394
UniProt: M4VW18
LinkDB All DBs
Position
595414..598296
Genome map
AA seq 960 aa AA seqDB search
MSVLTGMNAEYIAHLYARYMQSPEKTDPSWKAFFQDLNDNELAVLQDLAGASWTPDENKR
SRRSFGSNTGNVVGMTVASSAARASAPMPSGEMNDDVRRATLDSIRALMMVRAYRARGHL
LSNLDPLELKEKTYHPELDPAHYGFSDSDYDRPIFIDGVLGFETATLREIVTALRQTYCG
AVGVEFMHLSDPAEKSWIQQRIEAPRNQTDFTVEGKRAILQRLTAAESFEKFLHVKYVGT
KRFGLDGGESTVPAIEQVLKRGSQLGVKEVVFGMAHRGRLNVLTNVLGKPFTAVFSEFQG
NSANPDDVQGSGDVKYHLGTSTDREFDGKTLHLSLTANPSHLEVVDPVVIGKVRAKQQQR
GDKDRTQVLPILLHGDAAFAGQGLVAETLMMSELGGYRVGGTVHIVINNQIGFTTMPQYS
RSGPYPTDVAKMLAAPIFHVNGDDPEAVVHAARIAIEFRQEFKKDVVIDLVCYRRYGHNE
GDEPAFTQPLMYKKIKTHMSVRDMYSNKLVADGTLSEAESKAMVDEFNTYLEQAFEATKS
YKPNKADFLEGAWTGLKVASGDERRGVTAIDDAMMQKLGKALTTVPANFNINSKIARQLE
AKADMFKTGQGFDWATAEALAFGSLAAEGYNVRLSGQDCQRGTFSQRHAVVTDQEDESKY
CFLQHIGGTQGTFEVHDSPLSEAAVLGFEYGYSMADPKTLVLWEAQFGDFVNGAQVVIDQ
FISSAETKWLRMSGLVMLLPHGFEGQGPEHSSGRVERFLQNCAEDNWQVANCTTPANYFH
ILRRQMVRDFRKPLIIMTPKSLLRHKLAVSPASMMTGQSTFHRILWDDAMDQMNKPKDIK
RVILCSGKVYYDLFEEREKRGQKDAIILRLEQFYPFPAKALGEELSKYPNAEVIWCQEEP
YNQGGWHFVDRRIEDVLKSIKHKSSRPRYAGRPEAAAPATGLMKRHNAELAKFLDEALKG
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttgaccgggatgaacgcggaatatatcgcgcatctgtacgcccgttacatg
caaagcccggagaaaacggacccgagctggaaagccttctttcaggatttgaacgataac
gaactggctgtgttgcaggatttggctggcgccagctggacccccgatgaaaataaacgc
agccgccgctcctttggctccaataccgggaatgtcgtgggcatgacggtggcgtcatcc
gccgcgcgggcatccgcaccgatgccgtcgggcgagatgaatgatgatgtgcgccgtgcg
acgctggattccatccgggcgttgatgatggtgcgggcttatcgcgcgcgtggtcacctg
ctgtccaacctggacccgctggaactgaaagaaaaaacctatcacccggaactggacccg
gcgcattacggtttttccgattccgattatgaccgcccgatctttattgatggtgttctg
gggtttgaaacggcgacgttgcgcgaaatcgtgacggctctgcgccaaacctattgcggg
gctgtgggtgttgaatttatgcacctgagcgatccggcagaaaaatcatggatccagcag
cgtatcgaagcaccgcgcaaccaaaccgattttacggttgagggcaaacgcgccattctg
caacgtttgacggcggcggaatcgttcgaaaagttcctgcatgtgaaatatgtcggcacc
aaacggttcggtctggatggtggcgaatccaccgtgccggcgattgaacaggttttgaaa
cgcggatcgcaattgggcgtgaaggaagttgtgttcggcatggcccaccgtggccgtttg
aacgtgctgaccaacgttttgggcaaaccgttcacggcggtgttctcggaattccagggc
aattcggcgaacccggatgatgttcagggatcgggcgacgtgaaataccaccttggcaca
tccacggaccgtgaatttgatggcaagactttgcacttgtccctgaccgccaacccgtcc
cacttggaagtggtggacccggttgtgattggtaaggtccgcgcgaaacagcaacaacgt
ggtgacaaggatcgcacgcaagtcctgccgatcctgttgcacggcgatgccgcatttgcg
ggccagggattggtggctgaaacattgatgatgtccgaactgggcggttatcgcgtgggt
ggtacggtccatatcgtcatcaacaaccagattggttttacgaccatgccgcaatatagc
cgttcgggtccgtacccgaccgacgttgcgaaaatgctggccgcgccgatcttccacgtc
aatggtgatgacccggaggccgttgttcacgccgcccgcatcgccatcgaattccgtcag
gagttcaagaaggacgtggtgattgatctggtctgctatcgccgctatggccacaacgaa
ggggacgagccagcctttacccaaccgttgatgtacaaaaaaatcaaaacgcacatgtcg
gtgcgcgacatgtattccaacaagctggtggccgatggcacgctgagcgaagctgaatcc
aaagcgatggtggatgaatttaacacctatctggaacaggcgttcgaagcgaccaaatcc
tacaaaccgaacaaggccgatttcctggaaggtgcatggacggggttgaaggttgccagc
ggcgacgaacgtcgtggcgtgacggcaattgacgatgcgatgatgcagaaattgggcaaa
gcactgacgaccgtgccggccaatttcaacatcaattcaaaaatcgcccgtcaattggaa
gccaaggccgatatgttcaaaaccggacaagggtttgactgggccacggcggaagcgttg
gcattcggctccctggcggcggaaggatacaatgtccgcctgtctggtcaggattgccag
cgcggcacgttctcccaacgccacgccgttgtgacggatcaggaagatgaaagcaaatat
tgcttcctgcaacatattggcgggacgcaaggcacgttcgaagtgcatgacagcccgctg
tccgaagcggccgttctcggttttgaatatgggtattccatggccgatccgaaaacactg
gtcctgtgggaagcacagttcggtgacttcgtgaacggtgcgcaagtggtgattgaccag
ttcatttcatccgcagaaaccaaatggctgcgtatgtccggtctggtcatgctgttgccg
cacgggttcgaagggcaggggccggaacattcctccggtcgcgtggaacgcttcctgcaa
aactgtgccgaagataactggcaggtggcgaactgcaccaccccggccaactatttccac
attttgcgccgtcagatggttcgcgatttccgcaagccgttgattatcatgacgccgaaa
tccttgttgcgtcacaagctggcggtgtccccggcgtccatgatgacgggccagtccacg
ttccaccgcatcctgtgggacgatgcgatggaccagatgaacaagccgaaggacatcaaa
cgcgtgatcctctgctcgggcaaagtttattacgatctgtttgaagaacgtgaaaagcgc
ggccagaaagatgcgatcatcctgcgtctggaacaattctatccgttcccggcgaaagcc
ttgggcgaagaattgtccaaatatccgaacgccgaagtgatctggtgccaggaagagccg
tataaccagggtggctggcacttcgttgatcgccggatcgaagacgtactgaaatccatc
aaacacaaatccagccgtccgcggtatgcgggtcgcccggaagccgccgcaccggccacg
ggcctgatgaagcgccacaacgcagaactggccaagtttttggatgaggctctcaaagga
taa

DBGET integrated database retrieval system