KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2518Help
Entry
MAP4_2518         CDS       T02662                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGL37412
LinkDB All DBs
Position
2786630..2787628
Genome map
AA seq 332 aa AA seqDB search
MTDFAALPDSVRAALRDEPVPQWCSPTLATLTEKRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRKPLNGTYPELVESLAAQRETRFVLDGEVVAFEGRRTSFARLQGRLGITDPDV
ARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKAIDFTDPLRYAPHRVGDGMAAYR
AACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEFVVGGYTSPKGKRLELGALLLGY
YQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPFTRSLVPEAGAHWVRPELVVQIG
FTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgccgcgctgcccgattccgtgcgtgccgcgctgcgcgacgagcccgtg
ccccagtggtgctcgcccacgctggccaccctcaccgagaagcgattctccgacccacac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggccttccgcgacggcgaccgg
gtccggctgctgtcgcgaaaccgtaagccgctcaacgggacctacccggaattggtggag
tcgctggccgcgcagcgcgagacgcgcttcgtgctggacggcgaggtggtggcgttcgag
ggccgccgcaccagcttcgcccggctgcagggccggctgggcatcaccgaccccgacgtg
gcccgggcatcgtcggtgcgtatctactactacgtgttcgacctgctgcatctcgacggc
aagtcgaccgtcgcggtgccactgatctggcgtaagagattgctgcgcaaggcaatcgac
ttcaccgatccgctgcggtatgcaccgcaccgggtcggggacgggatggccgcgtaccgg
gcggcgtgcggtcgtggtgacgagggtgtgatcgccaagcgggccgaatcggcctatgac
ggccgccgctcggagaactggttgaagttcaaatgcgtgcgcgaccaggaattcgtggtc
ggcggctacaccagccccaagggcaagcggctcgagttgggcgccctgctgctgggctac
taccagggggaccagttgcgctacgccggcaaggtgggcaccggtttcgacgaggcgacg
ctacaccgcttgcaccagctgctgtccgggatcgcttgcgacacaacgccattcacccgg
agtttggtgcccgaggccggcgcgcactgggtgcgcccggagctggtggtccagatcggg
ttcaccgagtggacccgcgacggaaagctacgtcacccccgctatctcggcatccgcacc
gacaaggatcccaccgaggtgatccgggagacgcgctga

DBGET integrated database retrieval system