KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3530Help
Entry
MAP4_3530         CDS       T02662                                 

Definition
(GenBank) hypothetical protein
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3842675..3843703
Genome map
AA seq 342 aa AA seqDB search
MAAAEEVDVDGIAVRLTNPDKVYFPKLGSKGTKRHLIDYYRAVAGGPMLDALRDRPTHLQ
RFPDGIDGEEIYQKRIPQHHPDYLQTCRVTFPSGRTADALKVTHPAAIVWAAQMGTVTLH
PWQVRCPDTDHPDELRIDLDPQPGVAFAQARSVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDQLAGADPDDYTMATVPDLVSARENPWAAIDDVAQSIGPLL
RMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTEHKKKN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagaagaggtcgacgtcgacggcatcgcggtccgtctgacaaatccggac
aaggtgtatttccccaagctggggtcgaaaggcaccaagcggcacctgatcgactactac
cgcgccgtcgcgggcggcccgatgctcgacgcgctgcgcgaccggccgacccacctgcag
cgtttcccggacggcatcgacggcgaagagatctaccagaagcggattccgcagcaccat
cccgactacctgcagacctgccgggtgacgtttccgtcgggacggaccgccgacgcgctc
aaggtcacccacccggcggccatcgtgtgggcggcacagatgggcaccgtcaccctgcac
ccgtggcaggtgcgctgcccggacaccgaccatcccgacgagctccgcatcgatctggac
ccgcagcccggtgtcgcctttgcccaggcgcgcagcgtcgcggtcgacgtgctgcggccg
ctgctcgacgagctggggctggtgggctacccgaagacgtccggcggccggggcatccac
gtcttcctgcgcatcgccacggactgggatttcgtcgaggtgcgccgggcgggcatcgcg
ctggcccgggaggtggagcggcgcgcgcccgacgccgtcaccacctcctggtggaaggaa
gaacgcggcgcgcgcatcttcatcgacttcaaccagaacgcccgcgaccgcaccatggca
tcggcctattcggtgcggcgcaccccgatcgcgacggtgtcgatgccactgacctgggac
cagctggccggcgccgaccccgatgactacaccatggccacggtgcccgatctggtcagc
gcccgcgaaaacccttgggctgcaatcgatgacgtggcccagtcgatcggtccgctgctg
cggatggccgaggccgacgaggagcgcgggctcggcgacatgccctacccgccgaactac
ccgaaaatgcccggcgaacccaaacgcgttcagcccagccgggatacggagcacaagaag
aagaattga

DBGET integrated database retrieval system