KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0717Help
Entry
Maqu_0717         CDS       T00454                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
Translation factors [BR:maq03012]
 Eukaryotic Type
  Elongation factors
   Maqu_0717
 Prokaryotic Type
   Maqu_0717
Mitochondrial biogenesis [BR:maq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Maqu_0717
Exosome [BR:maq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Maqu_0717
  Exosomal proteins of breast cancer cells
   Maqu_0717
  Exosomal proteins of colorectal cancer cells
   Maqu_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
829164..830360
Genome map
AA seq 398 aa AA seqDB search
MSKAKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCHEVWGTGESRAFDQIDNAPEERAR
GITIATSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREH
ILLSRQVGVPFIVVFLNKADMVDDEELLELVEMEVRDLLSQYDFPGDDTPIITGSALMAL
EGKDDNEMGTTAVKKLVEALDDYIPEPERAIDQPFLMPIEDVFSISGRGTVVTGRVERGI
IKVGDEVEIVGIRDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLCVP
GSIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDN
VKMTVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaagcaaagtttgagcgtaacaagccgcacgtaaacgtgggcaccatcggtcac
gttgaccatggtaagaccactctgacagctgccctgactcgtgtatgtcacgaagtttgg
ggcactggcgagagccgtgctttcgatcagatcgataacgcaccggaagagcgtgcgcgt
ggtattaccatcgcgacctctcacgtagagtacgattctccgacccgtcactacgcccac
gtagactgcccgggccacgctgactatgtgaagaacatgatcactggtgcggcacagatg
gacggcgcgatcctggtttgctccgcagctgacggccccatgccgcagactcgtgagcac
atcctgctgtcccgtcaggttggcgttcctttcattgtcgtgttcctgaacaaggccgac
atggtagacgacgaggagctgctggagctggttgagatggaagttcgtgacctgctgagc
cagtacgacttcccgggtgacgacaccccgatcatcaccggttctgccctgatggcgctg
gaaggcaaagacgacaacgaaatgggtactaccgctgtcaagaagctggtagaagccctg
gacgactacattcctgagccggagcgtgcgatcgatcagccgttcctgatgccgatcgag
gacgtattctccatctctggtcgtggtaccgtagtaactggtcgtgttgagcgtggcatc
atcaaggttggtgacgaagtggaaatcgtgggtatccgcgacaccaccaagaccacctgt
accggtgttgagatgttccgcaagctgctggacgaaggtcgtgccggcgagaacgttggt
gttctgctgcgtggtaccaagcgtgacgacgttgagcgtggtcaggttctgtgtgtaccg
ggctccatcaagccgcacaccaagttcgagtgtgaagtgtacgtactgtccaaagaagaa
ggtggtcgtcatactccgttcttcaagggctaccgtccgcagttctacttccggaccact
gacgtgaccggttcttgcgaactgccggaaggcgtagaaatggtaatgccgggtgacaac
gtgaaaatgaccgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcg
attcgcgaaggtggtcgtaccgttggtgccggcgtggtcgccaagatcatcgagtaa

DBGET integrated database retrieval system