KEGG   Microcystis aeruginosa: MAE_14790Help
Entry
MAE_14790         CDS       T00647                                 

Gene name
ntcB
Definition
(GenBank) nitrate/nitrite transport system permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
mar  Microcystis aeruginosa
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    MAE_14790 (ntcB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    MAE_14790 (ntcB)
Transporters [BR:mar02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    MAE_14790 (ntcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1321659..1322486)
Genome map
AA seq 275 aa AA seqDB search
MAVSISRRSQGSKWVKDLKKKLPKLATSAIALLIFLAIWQILCFSPDAPLPSPTKVVSDT
WELIINPFFNNGGTDVGLFWQIFASLQRVAVGFTLAAIVGIAVGILIGSNALIYDAIDPI
FQILRTVPPLAWLPISLAAFRNNEPSAIFVIFITAIWPIIINTAVGVQQVPQDYKNVSRV
LKLSKVEYFFNILFPATVPYVFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSM
ISEIILALIYVGIVGFLLDRLMAYIAKLVVPEENK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttctatttctcgtcgttctcaaggttcaaaatgggtaaaagacctgaaaaaa
aaattacccaaactagcaacttcggcgattgctttattaattttccttgccatctggcaa
atactctgttttagtcccgatgcccccctccctagtcccactaaagtggttagcgatacc
tgggaattaattattaatcccttcttcaataatggtggcacggatgtggggttattctgg
caaattttcgccagtttacaacgggtggccgtcggttttaccctagccgctattgtcggc
atcgccgtaggaattttaatcggtagtaacgccctaatttatgatgcgatcgatccgatt
ttccaaatcctgcgtaccgttccccccctagcttggctacccatctccctagcggctttt
cgtaataacgaacctagtgccatatttgtaatttttattacagcaatttggccaattatt
attaacacggccgtgggagtacagcaggttccccaagactataaaaacgtctctagagtg
ctaaaattatccaaagttgaatactttttcaatattctttttcccgctactgttccctac
gttttcacgggattaagaatcggtatcggtttatcttggttggcgattgtagcggcggaa
atgctgatcggtggcgtgggaattggcttctttatctgggatgcttggaatagttccatg
atcagtgaaattatcctcgccctgatttatgtgggtattgttggtttcttactcgatcgc
ctcatggcctacatcgctaaattagttgtacccgaagaaaataaatag

DBGET integrated database retrieval system