KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_03370Help
Entry
YQ22_03370        CDS       T04570                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00620  Pyruvate metabolism
marm00680  Methane metabolism
marm01100  Metabolic pathways
marm01120  Microbial metabolism in diverse environments
marm01200  Carbon metabolism
Module
marm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:marm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YQ22_03370
  Energy metabolism
   00680 Methane metabolism
    YQ22_03370
Enzymes [BR:marm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YQ22_03370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF3837 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APA63439
LinkDB All DBs
Position
complement(827838..830384)
Genome map
AA seq 848 aa AA seqDB search
MQQKERLAEFKKSVQNKFNVYNSLFLNLPYENIENVGMLIPLLLNQSEKGLSDGLNPKEI
LENFFENFVEIKSEKEQIDFMFRIIQYVERQVVLYDSVEDAAFPKLHKHSSSLSLKDYFQ
LVEKNKSWDTIWDKLSTFSARIVLTAHPTQFYTPAVLDIITNLRTLILEDKIDEIDVGLQ
QLGLTSLINAKKPTPLDEAKNIIYTLRHVYYDAIGDMYAYIKGSTGSKNFENHDIVKLGF
WPGGDRDGNPFVTADITRDVMNELRLTLMKCYYNDLKGLVHKLTFKDVQEPLQKLRGNLY
TAMFDSSKDIGYEDLIVPLEEIQSILIEKYQSLYLKDLEKFIDKVKIFKVHFATIDIRQD
HSMHTKVMVEVLKKNGFINDELSELSDEELLDILLHKNLNLVADDYEVDIVKDTIKNILQ
LQTIQAKNGEEGCNRYIISNSEDKYSILFVYALFRWCGWADKEITFDIVPLFETMNGMDT
AQDTMKFLFSLPEYMDHLENRNKKQTIMLGFSDGTKDGGYLKANWSILKTKEELSEVCDQ
NDIAAVFFDGRGGPPARGGGKTHRFYAAQTNKVANNEIQLTIQGQTITSTYGTKEQFIYN
SEQLLTAGLSNTILGKEIVISDADRELIEELSELSFKKYDDLKHHDKFMPYLENMSTLKY
YTKANIGSRPGKRGNKAKLELSDLRAISFVGSWSQLKQNVPGYYGIGTALEKLEKDGRFE
EAKRLYQEVPFFQALMMNSMMSLTKCYFELTSYMKENKEYGAFWEILHAEYELSKAMLLK
LSGMEILMKKEAISRESIKIRESIVLPLLVIQQYALQRIGEGTEYKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaaagaaagattagcagaatttaagaaatctgttcaaaataaatttaatgtt
tacaatagtctattcttaaaccttccctacgagaatattgaaaatgtaggtatgttgatt
cctttattactgaatcaatctgaaaaggggttaagtgacggactaaacccaaaagaaatt
cttgagaattttttcgagaattttgtagaaataaaatcagaaaaagaacaaatagacttt
atgtttcgcatcatacagtatgtagaaagacaagttgttctttatgatagtgtagaagat
gcggcgtttccaaagttacacaagcattctagttcattgtcattaaaagattattttcag
ttggttgaaaagaataaatcttgggatactatttgggacaagttgagtacgttcagtgca
cgtatagttttaacggcgcacccaacacaattttatactccggcggttttagatatcatt
acaaaccttagaactttaatattagaagataaaattgatgaaatagatgtaggtcttcaa
caattaggccttacgtctttgatcaatgcaaaaaaaccgacaccattagatgaagccaaa
aatataatctacacgctaagacatgtatattatgatgcaattggtgatatgtatgcttat
atcaagggtagtacagggtcaaagaattttgaaaatcatgacattgtcaagttaggtttt
tggcctggcggtgatagagatggaaatccgtttgtaactgcagatatcaccagagatgta
atgaacgagcttcgtttaacgttaatgaagtgctattataatgaccttaaaggtttggtg
cataaactcacctttaaagatgtacaagaaccgttgcagaagcttaggggtaatttatac
acggccatgttcgatagttctaaggatattggttatgaagatttaattgttcctttagaa
gaaatacaatccatattaatagaaaaataccaaagtctttatctaaaagatttggaaaaa
tttattgataaggtaaagatattcaaagtgcactttgctacaatagatatacgtcaagac
catagtatgcataccaaagttatggtagaagtattaaaaaagaatggttttataaatgat
gagctaagtgagttatctgacgaggaattattggatattcttttgcataagaatttaaat
ttggtagcagatgattatgaagtagatattgtaaaagatactattaagaatatacttcaa
ttacagaccatacaggctaaaaatggagaagaaggatgtaatagatacattatcagtaat
tctgaagataagtattccattttgtttgtttacgcactgtttagatggtgtggctgggca
gacaaagaaataacgtttgatatagtgcctttattcgaaacaatgaacggaatggataca
gctcaagataccatgaagtttttattcagtttacctgagtatatggaccatttagaaaat
agaaataaaaagcagactataatgcttggattttccgatggtactaaagatgggggctat
ttaaaagccaactggtcaattttaaagacaaaagaagagctttcagaggtttgtgatcag
aatgatattgctgccgtattttttgatggtaggggaggcccaccggcaagaggaggtgga
aaaacgcatcgtttttatgctgcccagaccaataaagtggcgaacaatgaaattcaatta
actattcaagggcagaccataacaagtacttatggtaccaaagaacagtttatttataat
agtgagcaactattgaccgccggattgtctaacacaattttaggaaaagaaattgttata
tctgatgctgatagagagttgattgaagagctgtcagaactaagttttaaaaagtatgat
gatctaaaacaccatgataagtttatgccgtacttggaaaacatgagtacgcttaaatat
tacacaaaagcaaatattggtagtagacctggaaaaagaggaaataaggctaaacttgaa
ttgtctgatttaagggcaatttcatttgtagggtcatggagtcaattaaagcagaacgta
ccaggttattatggtattggtactgctcttgagaaacttgaaaaagatggaagatttgaa
gaggccaaaaggttgtaccaagaagtaccgttctttcaagctttgatgatgaacagtatg
atgagtcttaccaaatgttattttgaattgaccagttatatgaaagaaaataaggagtat
ggtgctttttgggagattcttcatgcagaatatgaattatctaaagcaatgcttctaaaa
ctatctggcatggaaatattaatgaagaaagaagcaatttctagggagtccatcaaaatt
cgtgagagtatagtcttgcctttattggttattcaacaatatgcgcttcaaaggattgga
gaaggtacggagtataaagaattgtacgaaaagattgttaccagatcactatacggtaat
atcaatgctagtagaaactcagcatag

DBGET integrated database retrieval system