KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_10855Help
Entry
YQ22_10855        CDS       T04570                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:marm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YQ22_10855
  Amino acid metabolism
   00310 Lysine degradation
    YQ22_10855
   00380 Tryptophan metabolism
    YQ22_10855
Enzymes [BR:marm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     YQ22_10855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2594703..2597498
Genome map
AA seq 931 aa AA seqDB search
MDKYSFLNTAHTSFFSELYDKYLVNPDSVEPSWRAFFQGFDFGMESSLDELEIDENRTTV
VVNGNKSEMPESLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRHYEPSLEIENFGLSSSD
LETVFNAGDIIGIGPSALKEIVRHLQSIYCDAIGVEYMYIRKPERVKWIQDWINVNDNHP
DFEPDRKKHILKKLNHAISFETFLHTKYVGQKRFSLEGNESLIPALDVIVERAAEMGVKQ
FVMGMAHRGRLNVLTNIFGKSAKDIFSEFDGKDYEQEIFDGDVKYHLGWTSDRKSDNGNK
INMSIAPNPSHLETVGAVVEGIARAKQDADYQDDISKVLPIVVHGDAAIAGQGLVYEVVQ
MAGLDGYKTGGTIHIVVNNQIGFTTNYLDARTSTYCTDVAKVTLSPVLHVNADDAEAVVH
ASLFALEYRMQFESDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHKNPRDIYAERLI
QEGVIDDTYVSELEKQYKDSLEEKLEDSRKEDKTVITPFMADEWKGFENVREWEMMDPVN
TKFTKTKLDKIAKVITALPKGKKFLRKVEKLVKDRYNMYFEADNLDWAMGELLAYGSLLE
EGYAVRMSGQDVERGTFSHRHAVMKVEESEEEIILLNQLSDKQAKFQIYNSLLSEYGVVG
FDYGYAMASPKTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQG
AEHSSARMERYLQLCAKDNMYIADVTTPAQMFHILRRQMKANFRKPLIIFTPKSLLRHPK
AVSKIADLTGGGFQEVIDDETADAKKVKSLVFCTGKFYYDLLAVKEENSRDDVALVRVEQ
LFPIPEKKMKEAIAKYKNADDIVWAQEEPRNMGAWSHLLMHFDEARTFRVASRRFYAAPA
AGSSVRSKARHQQVIDYVFDKTKDNMSKPKK
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttgaataccgctcatacctcttttttttcagagttatacgat
aagtatttagtaaatccggatagtgtagaaccaagttggagagccttttttcaaggattc
gactttgggatggaaagttcattagatgaacttgaaattgatgagaacagaactactgtt
gtagtaaacggtaataagagtgaaatgccagaatccttgcaaaaagagtttcaggtaatc
agacttattgacggttatagaagcagaggtcacttatttacgaaaacaaacccggttcgt
gagcgaagacattatgaaccttcattggaaatagaaaatttcggactttcatcgtctgat
cttgaaaccgtttttaatgcaggtgatataattggtataggtccaagtgccctcaaagaa
attgttagacatttacaaagtatctattgcgatgctattggtgttgagtatatgtatatt
cgaaaaccagagcgtgtaaaatggattcaagactggattaatgtcaatgacaaccatcct
gattttgagccggatagaaaaaagcatattcttaaaaagttgaatcatgccatttctttc
gagacttttttgcatacaaaatatgtgggtcagaaaagattctccttagaagggaatgaa
tcattgatacctgccttagatgtaattgttgagcgtgccgcagaaatgggcgtaaagcag
tttgttatgggtatggcacaccgtggaagattaaatgttctaaccaatattttcggaaaa
tcggctaaagatatttttagtgaattcgatggtaaggattatgagcaggagatttttgat
ggcgatgttaagtatcacctaggctggacttcagatagaaaatctgataacggaaataaa
attaacatgagcattgcaccaaatccttctcacttagagactgtaggtgcagtggttgaa
ggtattgcaagggcaaagcaagatgcggactatcaagatgatatttcaaaagtgcttcct
attgtagtacatggtgacgccgccatagcaggtcaaggtttggtatatgaagttgtccaa
atggctggtcttgatggttataaaaccggaggtactatacatattgtagtaaacaatcaa
attggatttaccactaactatctagatgctagaacatctacctattgtacagatgtagcc
aaagttactttgagtccagtattgcatgttaatgctgatgatgccgaggctgtggtacac
gcatcactttttgcattggaatataggatgcaatttgagagcgatgtatttatagatttg
ttagggtatagaaagtatgggcataatgaaggtgatgagccaagatttacccagccaaaa
ctatacaaagctatttccaagcataagaacccaagggatatttatgctgaaagactaatt
caagaaggtgttattgacgatacctatgtttctgaattggaaaaacagtataaagattca
ttagaggaaaaacttgaagattcacgtaaggaagataaaactgtaataaccccgttcatg
gcagatgaatggaaaggttttgaaaatgttcgtgaatgggaaatgatggacccggtgaat
accaagttcaccaagaccaaattagataaaattgccaaagtaataactgcgttgccaaag
ggtaaaaagtttttacgcaaagtagaaaaactagtcaaagatcgctacaatatgtatttt
gaagcggataatttggactgggccatgggtgaattattggcatatggttctcttttagag
gaaggttatgctgtgcgtatgtccggacaggatgttgaacgtggtactttctctcaccgt
catgccgtcatgaaggttgaagagagcgaggaagaaataatcttgttgaaccagctttct
gataagcaagcaaagtttcagatttataattcacttttatcggaatacggtgttgtaggt
tttgattatggttatgccatggccagccctaaaacattgacgatatgggaagctcagttt
ggggatttcagtaatggggcccaaattatgatagaccaatatatttctgccgcagaagat
aagtggaaacttcaaaatggtttggtaatgctcttaccacatggttatgaaggtcaaggt
gcagaacactcttccgctagaatggagcgttacttgcaattgtgtgcaaaagataatatg
tacatagcagatgtaactacaccagcgcaaatgttccatattttgcgtagacaaatgaag
gctaattttagaaagccattgatcattttcactcctaaaagtttgttgagacatccaaaa
gctgtgtctaaaatagcggatttaacaggtggtggtttccaagaggtcatagatgatgag
actgcagatgctaaaaaagtaaaatcattggtattctgtacaggtaagttctattatgat
cttttagctgttaaagaagagaatagtagagatgatgtggcactggtaagggttgaacaa
ttgttccctattccggaaaagaaaatgaaggaagccattgcaaaatataagaatgcagac
gatattgtttgggctcaagaagaacctagaaatatgggtgcatggagccatttattaatg
cattttgacgaagctagaacttttagggttgcttcaaggcgtttttatgcagctccggca
gcaggtagttctgtgcgttcaaaagcacgtcatcaacaagttatagattacgtttttgat
aaaacgaaggacaatatgtccaaaccaaaaaaataa

DBGET integrated database retrieval system