KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_12900Help
Entry
YQ22_12900        CDS       T04570                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00010  Glycolysis / Gluconeogenesis
marm00052  Galactose metabolism
marm01100  Metabolic pathways
marm01110  Biosynthesis of secondary metabolites
marm01120  Microbial metabolism in diverse environments
marm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:marm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YQ22_12900
   00052 Galactose metabolism
    YQ22_12900
Enzymes [BR:marm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     YQ22_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: APA65136
LinkDB All DBs
Position
3061696..3062892
Genome map
AA seq 398 aa AA seqDB search
MKLINISKYLVLIITILIIYLDFNMEYVKGIWQNDKISMRIKKSNYGVTVNKEKVELYKL
YNLDGIQVSIITFGGRITAVETPDKDGNIKNVVLGFKNLEQYEKPNPYFGALVGRYGNRI
AKGKFILNNYEYQLAKNNGENSLHGGVVGFDKVVWKVEDIQENKTSASLKLSYYSKDMEE
GFPGNLKTTVTYTLNSDNSLDVLYEATTDKTTIVNLTQHSYFNLSGDFSQPIIDHVVEIN
ADKFVPVNASLIPTGELAVVDGTPFDFRIPKLVSKAINMSNDQITLGGGFDHCWVLNNSD
KGYRRVAKAYHPESGRGVEVITDQPGMQFYTGNFLDSTLPRPNCGFYAKRSGFCFETQHF
PDAPNQPSFPSVVLTPEEKYLTKTTFKFTVNKPLTCNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgattaatatatctaagtatttggtgttgattattactattttgataatatat
ttagatttcaacatggaatatgttaaggggatttggcaaaatgataaaatttcaatgagg
attaaaaaaagtaattatggtgttacggtaaataaggaaaaggtagaattatacaaactg
tataatttggacggaattcaagtaagcataataacttttggaggaagaataacagctgtt
gaaactcctgataaagatggaaatattaagaatgttgttttaggtttcaaaaacttggag
cagtacgaaaaacctaacccatattttggagctcttgttggaagatatggaaatcgtatt
gcaaaagggaaattcatcttaaacaattacgaatatcaactagcaaaaaataatggtgaa
aatagtctacacggtggtgtggtaggttttgataaagtggtttggaaagttgaagatatt
caggaaaataaaacctcggcttctttaaaacttagttactatagtaaagatatggaagag
ggttttcccggtaatttaaaaacaacggtcacctacacactaaattctgataacagtctt
gatgttttatacgaagcaactacagataaaactaccattgtaaaccttacacaacattcc
tattttaatctttcgggggatttctctcaacctataattgatcatgtcgtggagatcaat
gcagacaaatttgtgccagtgaatgcttcgctgattcctacaggtgagttggcagttgta
gatggtacaccgttcgattttagaataccaaaattggtgagtaaagctataaacatgagc
aacgatcaaattactttaggtggtggttttgatcattgctgggtgttgaacaattctgat
aaagggtataggcgtgtagcaaaggcatatcacccagaatcgggcagaggtgttgaagta
attacggatcaaccaggtatgcaattttatacaggaaattttttagatagtacgctacca
agaccaaactgtggtttttacgcaaaaagaagtggcttttgttttgaaacccaacatttt
ccagatgcaccaaatcaaccaagttttccttctgtagtactaactccggaagaaaaatac
ctgacaaaaaccacttttaaattcacagttaataaaccattaacatgcaacagttag

DBGET integrated database retrieval system