KEGG   Mahella australiensis: Mahau_2158Help
Entry
Mahau_2158        CDS       T01494                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
mas  Mahella australiensis
Brite
Translation factors [BR:mas03012]
 Eukaryotic Type
  Elongation factors
   Mahau_2158
 Prokaryotic Type
   Mahau_2158
Mitochondrial biogenesis [BR:mas03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mahau_2158
Exosome [BR:mas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mahau_2158
  Exosomal proteins of breast cancer cells
   Mahau_2158
  Exosomal proteins of colorectal cancer cells
   Mahau_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2287741..2288940)
Genome map
AA seq 399 aa AA seqDB search
MAKQRFERSKPHINIGTIGHVDHGKTTLTAAITMTLAHFGRAQATKYDEIDKAPEEKARG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKTDMVDDPELIELVEMEVRDLLNEYEFPGDEVPIIKGSALKALE
AGGDPNNEWVKPILELMDAVDEYIPTPERDVDKPFLMPVEDVFTITGRGTVATGRVDRGR
LRVGEEVEIVGLTDRPRKTVATGIEMFRKTMDEAIAGDNVGVLLRGIQREEVERGQVLAK
PGSIHPHTHFKGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTIQLPEGVEMVMPGD
NIVMEVQLITPIAIEEGLRFAIREGGRTVGAGVVTEVIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaagatttgagagaagcaagccgcatataaatataggtacaatagggcac
gtcgatcacggcaagacgacgttgacagcagctataacgatgacgctggcacattttggc
cgggcgcaggctaccaaatacgatgagatagacaaagcgcccgaagaaaaagccaggggc
atcacaataaacacggcgcacgtggaatacgagaccgagaagaggcactatgcgcacgtt
gactgtccagggcacgccgactatgttaagaacatgataaccggcgcagcgcagatggac
ggagcgatactggtggtatcggcagccgacggtcccatgccgcagaccagggagcatata
ctgctggcgcgccaggtaggagtgccatatatagtggtatttttgaataagaccgatatg
gtagacgatcccgaactgatagagctagtagagatggaagtaagggatctgttaaatgaa
tacgaattcccgggagatgaagtaccgataataaaagggtcggcactaaaggcattagaa
gcgggaggagacccgaataacgaatgggtaaaaccgatacttgaacttatggatgcggta
gatgaatatataccgacacccgagagggatgtagacaagccgttcctgatgccggtagaa
gacgtattcacgataaccgggcgtggcacagtggctacaggcagagtagatcgaggcaga
ttaagagtaggcgaagaagtagagatagtagggttaacagaccgtccgaggaagacagta
gcgacgggtatagagatgttccgcaagacgatggacgaagcgatagcaggggacaacgta
ggcgtactgttaaggggcatacagagagaagaagtagagagagggcaggtattggccaag
ccgggcagcatacatccgcatacgcatttcaaggggcaggtatacgtgctgaccaaggaa
gaagggggtaggcatacgccgtttttcaacggatacaggccacagttctacttcaggacg
accgatgtgacaggtacgatacaattacccgaaggggtagagatggtaatgcctggcgac
aacatagtaatggaagtacagctgataacgccgatagcgatagaagaaggattgcgattt
gcaatacgagaaggcggccgaacggtaggagccggagttgtcaccgaggttatagaataa

DBGET integrated database retrieval system