KEGG   Massilia sp. B2: CR152_16085Help
Entry
CR152_16085       CDS       T05157                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mass  Massilia sp. B2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mass00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CR152_16085
   00052 Galactose metabolism
    CR152_16085
Enzymes [BR:mass01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CR152_16085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3608681..3609742
Genome map
AA seq 353 aa AA seqDB search
MQASIKQTAFGHLPDGRAATLTTLTNPNGLVVKITDFGGIITEIHTPDRNGTLADITLGF
DTVAPYVKDSPYFGALIGRYGNRLRGGRFTLDGQVVQLPTNNGPNHLHGGELGFHRVLWR
AIPFQEGDSVGVTLIYRSPDGEQGYPGTLDVTVVYELTAADELVVAFDAVTDKATPVNLT
QHAYFNLAGGGDILGHVLRIDADATTPIDHTLIPTGELAPVAGTAFDFRTPHAIGERIGN
DDEQLRHAGGYDHNFVLNKPAPRATTLAARVHEPVSGRVLELFTEEPGVQFYSGNFLDGT
LSGKGRTYGFRSGFCLEPQHFPDSPNQSTFPNTILRPGEEYATVSRYKFSVEK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagccagtatcaagcaaaccgcattcggccatctgcccgacggcagggccgccacg
ctgaccaccttgaccaacccgaacgggctggttgtcaagatcaccgatttcggcggcatc
atcaccgaaatccatacgcccgaccgcaacggcacccttgccgatatcacgctcggcttc
gacacggtcgcgccgtacgtgaaggactcgccgtacttcggcgcactgatcgggcgctac
ggcaatcgcctgcgcggtggccgcttcacgctcgacggccaggtggtgcaactgcccacc
aataacggccccaaccacttgcacggcggcgagctgggcttccaccgcgtgctgtggcgc
gccattcctttccaggaaggcgactcggtcggcgtcaccctgatctaccgcagccctgac
ggcgagcagggctatcccggcacgctcgacgtgaccgtggtgtacgaactgaccgccgcc
gacgagctggtggtcgccttcgatgcggtgaccgacaaggccacgccggtcaacctgacc
cagcacgcgtacttcaacctggccggcggcggcgacatcctcggccacgtgctgcgtatc
gatgccgatgccaccacgccgatcgaccataccctgattcccacgggcgaactggcgccg
gtggccggcaccgccttcgatttccgcacgccgcacgccatcggcgagcgcatcggcaac
gatgacgagcaattgcgccacgccggcggctacgaccataacttcgtgctcaacaaacct
gcacccagggcgacgaccctggccgcgcgcgtgcacgagccggtgtcgggccgggtgctc
gaactgttcacggaagaaccgggcgtgcagttttacagcggtaatttcctcgacgggaca
ctgagcggcaagggccggacctacggctttcgcagcggcttctgcctggaaccgcagcac
tttcccgattcgcccaaccagagcacgtttccgaacactatcttgcgccctggtgaggaa
tatgcgactgtatcgcggtacaaattttcggtggagaagtga

DBGET integrated database retrieval system