KEGG   Massilia sp. WG5: AM586_16060Help
Entry
AM586_16060       CDS       T04122                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
masw  Massilia sp. WG5
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:masw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AM586_16060
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AM586_16060
Enzymes [BR:masw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AM586_16060
Peptidoglycan biosynthesis and degradation proteins [BR:masw01011]
 Precursor biosynthesis
  Racemase
   AM586_16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3631798..3632937
Genome map
AA seq 379 aa AA seqDB search
MAGVANGAAQGVAHGVDAARAGAVLTIDLDAIRANYRLLRETAAGASCAAVMKADAYGLG
MDIVAPALALEGCRVFFTAHLEEGVRLRQIAPADSAIYVLHGPPPGTAADFVRHGLVPVL
NDPSQIEEWRRAGRLLQRRLPAALQFDTGMSRMGLAPCDVDALLADPAWKDELEPVLVMS
HLACADEPEHPMNDLQRARFAQLRARFPGIPGSLANSSAVFLGQGFRHDLVRPGAALYGI
NPQPGHANPLRQAVSLHARIVQSRMVAAGDVVGYGARHAVTGPARIATIGIGYADGWLRS
LSGRGHAWIDGMRVPFAGNVSMDSITLDVSGIDEARVAPGQEIELLGSHQTVDEVAREAG
TIGYEVLTRLGGRFHRRYA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgttgcgaatggcgccgcgcagggcgtcgcgcatggagttgatgccgcgcgc
gccggggcggtgctgacgatcgacctcgatgcgatccgcgcgaactatcgcctgctgcgt
gaaacggcggccggggccagctgcgccgccgtgatgaaggccgacgcctatggcctcggc
atggacatcgtggcgcccgcgctggcgctcgaaggctgccgcgtgttcttcaccgcccat
ctcgaagaaggcgtgcggctgcgccagattgcgcccgcggacagcgccatctacgtgctg
cacggcccgccgcccggcacggcggccgacttcgtccggcatggactggtgccggtgctg
aacgacccgtcccagatcgaggaatggcgccgcgccggcaggctgctgcagcggcgcctg
ccggccgcgctgcagttcgataccggcatgtcgcgcatgggcctggccccgtgcgacgtc
gacgccctgctcgccgacccggcctggaaggacgaactcgagccggtgctggtgatgagc
cacctggcctgcgccgacgagcccgagcacccgatgaacgacctgcagcgcgcgcgcttc
gcgcagctgcgcgcgcgcttcccgggcatcccgggcagcctggcgaattcctcggccgtg
ttcctgggccagggcttccgccacgacctggtgcgcccgggcgccgcgctgtacggcatc
aacccgcagccggggcatgccaatccgctgcgccaggcggtctcgctgcacgcccgtatc
gtgcagtcgcggatggtggcggccggcgacgtcgtcggctacggcgcgcgccatgccgtc
accgggccggcgcggatcgccaccatcggcatcggctatgcggacggctggctgcgttcg
ctgtcggggcgcgggcatgcctggatcgacggcatgcgcgtgccgtttgccgggaacgtg
tcgatggacagcatcacgctggatgtaagcgggatcgacgaggcgcgggtggcgccgggg
caggaaatcgagctgctggggtcacaccagacggtggatgaggtggcgcgcgaggcgggc
accattggctatgaagtgctgacgcggctgggtgggcgcttccatcgccgctacgcctag

DBGET integrated database retrieval system